DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and CG6347

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_610906.1 Gene:CG6347 / 36531 FlyBaseID:FBgn0033874 Length:352 Species:Drosophila melanogaster


Alignment Length:347 Identity:117/347 - (33%)
Similarity:179/347 - (51%) Gaps:23/347 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTVVHGLILLLLVEL----GLTAVSDTE-WDQYKAKYNKQYRNRDK-YHRALYEQRVLAVESHNQ 64
            |.:..||.||..|.|    ....:.|.: :|.:..:..|.|.:.:: |..:::..::..:...|:
  Fly     9 LQMTLGLALLGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYSDEERVYRESIFAAKMSLITLSNK 73

  Fly    65 LYLQGKVAFKMGLNKFSD-TDQRILFNYRSSIPAPLETSTNALTETVNYKR--YDQITEGIDWRQ 126
            ....|...|::|:|..:| |.:.|.....|.|....|..||.....|..:.  ...:.|..|||:
  Fly    74 NADNGVSGFRLGVNTLADMTRKEIATLLGSKISEFGERYTNGHINFVTARNPASANLPEMFDWRE 138

  Fly   127 YGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCV-PYPNNGCSGGWVSVA 190
            .|.::|.|.||..|.:||:|:|:|.||.|:.::.|.|..||.::||||. .|.|.||.||:....
  Fly   139 KGGVTPPGFQGVGCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQEYG 203

  Fly   191 FNYTRDHGIATKESYPYEPVSGECLWKSDRSAG--------TLSGYVTLGNYDERELAEVVYNIG 247
            |.|.||||:.....|||.....:|  :.:.:||        .:..|.|:...||.::.||:..:|
  Fly   204 FEYIRDHGVTLANKYPYTQTEMQC--RQNETAGRPPRESLVKIRDYATITPGDEEKMKEVIATLG 266

  Fly   248 PVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGES 312
            |:|.|::.....|:|||||:.....|  .:.:|.|||.:||:|| ....|||||||||..:|||.
  Fly   267 PLACSMNADTISFEQYSGGIYEDEEC--NQGELNHSVTVVGYGT-ENGRDYWIIKNSYSQNWGEG 328

  Fly   313 GYLKLARNANNMCGVASLPQYP 334
            |::::.|||...||:||...||
  Fly   329 GFMRILRNAGGFCGIASECSYP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 11/56 (20%)
Peptidase_C1A 120..334 CDD:239068 89/222 (40%)
CG6347NP_610906.1 Inhibitor_I29 38..97 CDD:285458 11/58 (19%)
Peptidase_C1A 131..350 CDD:239068 89/223 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449289
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.