DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctsf

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001029282.1 Gene:Ctsf / 361704 RGDID:1308181 Length:462 Species:Rattus norvegicus


Alignment Length:312 Identity:96/312 - (30%)
Similarity:151/312 - (48%) Gaps:28/312 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TEWDQYKAKYNKQYRNRDKYHRALYEQRVLAVESHNQLYLQGKVAF-----KMGLNKFSD-TDQR 86
            |.:..:...||:.|.:|::      .|..|.|.:.|.:..|...|.     :.|:.|||| |::.
  Rat   163 TLFKDFMTTYNRTYESREE------AQWRLTVFARNMIRAQKIQALDRGTAQYGITKFSDLTEEE 221

  Fly    87 ILFNYRSSIPAPLETSTNALTETVNYKRYDQITEGIDWRQYGYISPVGDQGTECLSCWAFSTSGV 151
            ....|.:.:.........:|.:::|    |......|||:.|.::.|.|||. |.||||||.:|.
  Rat   222 FHTIYLNPLLQKESGGKMSLAKSIN----DLAPPEWDWRKKGAVTEVKDQGM-CGSCWAFSVTGN 281

  Fly   152 LEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYTRD-HGIATKESYPYEPVSGECL 215
            :|.......|.|:.||.:.|:|| ...:..|.||..|.|:...:: .|:.|::.|.|:.....|.
  Rat   282 VEGQWFLNRGTLLSLSEQELLDC-DKMDKACMGGLPSNAYTAIKNLGGLETEDDYGYQGHVQACN 345

  Fly   216 WKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLS--IPACRSKRQ 278
            :.:..:...::..|.|.. ||.::|..:...||::|:|:....:|  |..|:..  .|.|.....
  Rat   346 FSTQMAKVYINDSVELSR-DENKIAAWLAQKGPISVAINAFGMQF--YRHGIAHPFRPLCSPWFI 407

  Fly   279 DLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNANNMCGVASL 330
            |  |:|||||:| :|....||.||||:|.||||.||..|.| .:..|||.::
  Rat   408 D--HAVLLVGYG-NRSNIPYWAIKNSWGRDWGEEGYYYLYR-GSGACGVNTM 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 16/60 (27%)
Peptidase_C1A 120..334 CDD:239068 75/214 (35%)
CtsfNP_001029282.1 Inhibitor_I29 165..221 CDD:214853 16/61 (26%)
Peptidase_C1 249..460 CDD:395062 75/216 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343563
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.