DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and CtsB1

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001259536.2 Gene:CtsB1 / 32341 FlyBaseID:FBgn0030521 Length:340 Species:Drosophila melanogaster


Alignment Length:327 Identity:84/327 - (25%)
Similarity:132/327 - (40%) Gaps:100/327 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 QGKVAFKMGL----NKFSDTDQRILFN--YRSSIPAPLETSTNALTETVNYKRYDQITEGID--- 123
            :|.:...||:    :||:..|:|.:..  |.:|:                    |::.|..|   
  Fly    51 EGHIRRLMGVHPDA
HKFALPDKREVLGDLYVNSV--------------------DELPEEFDSRK 95

  Fly   124 -WRQYGYISPVGDQGTECLSCWAFSTSGVLEA-------HMAKKYGNLVPLSPKHLVDCVPYPNN 180
             |.....|..:.|||: |.|||||   |.:||       |...|..  ...|...||.|......
  Fly    96 QWPNCPTIGEIRDQGS-CGSCWAF---GAVEAMSDRVCIHSGGKVN--FHFSADDLVSCCHTCGF 154

  Fly   181 GCSGGWVSVAFNYTRDHGIATKESY-------PYE------PVSG------------ECL----- 215
            ||:||:...|::|....||.:...|       |||      .|:|            :|.     
  Fly   155 GCNGGFPGAAWSYWTRKGIVSGGPYGSNQGCRPYEISPCEHHVNGTRPPCAHGGRTPKCSHVCQS 219

  Fly   216 -----WKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRS 275
                 :..|:..|:.| |....|.  ||:.|.:...|||..:.. ::|:...|..||..    ..
  Fly   220 GYTVDYAKDKHFGSKS-YSVRRNV--REIQEEIMTNGPVEGAFT-VYEDLILYKDGVYQ----HE 276

  Fly   276 KRQDL-THSVLLVGFGTHRKWGD----YWIIKNSYGTDWGESGYLKLARNANNMCGV-----ASL 330
            ..::| .|::.::|:|.   ||:    ||:|.||:.||||:.|:.::.|..:: ||:     |.|
  Fly   277 HGKELGGHAIRILGWGV---WGEEKIPYWLIGNSWNTDWGDHGFFRILRGQDH-CGIESSISAGL 337

  Fly   331 PQ 332
            |:
  Fly   338 PK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 5/20 (25%)
Peptidase_C1A 120..334 CDD:239068 74/269 (28%)
CtsB1NP_001259536.2 Propeptide_C1 24..64 CDD:285358 3/12 (25%)
Peptidase_C1A_CathepsinB 88..336 CDD:239111 71/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452954
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.