DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and ctsla

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_005165325.1 Gene:ctsla / 321453 ZFINID:ZDB-GENE-030131-106 Length:363 Species:Danio rerio


Alignment Length:364 Identity:124/364 - (34%)
Similarity:195/364 - (53%) Gaps:53/364 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GTPRLTVVHGLILLLLVELGLTAV---------SDTEWDQYKAKYNKQYR-NRDKYHRALYEQRV 56
            ||.|:.::.  :.|....|.|:||         .:..|||:|..::|:|. ..:.:.|.::|:.:
Zfish    20 GTTRVFIMR--VFLAAFTLCLSAVFAAPTLDQQLNDHWDQWKKWHSKKYHATEEGWRRIIWEKNL 82

  Fly    57 LAVESHNQLYLQGKVAFKMGLNKFSD---TDQRILFN---------YRSSI---PAPLETSTNAL 106
            ..:|.||..:..|...:::|:|.|.|   .:.|.:.|         :|.|:   |          
Zfish    83 KKIEMHNLEHSMGIHTYRLGMNHFGDMTHEEFRQVMNGFKHKKDRRFRGSLFMEP---------- 137

  Fly   107 TETVNYKRYDQITEGIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHL 171
                   .:.::...:|||:.||::||.||| ||.|||||||:|.||..|.:|.|.||.||.::|
Zfish   138 -------NFIEVPNKLDWREKGYVTPVKDQG-ECGSCWAFSTTGALEGQMFRKTGKLVSLSEQNL 194

  Fly   172 VDCV-PYPNNGCSGGWVSVAFNYTRD-HGIATKESYPYEPVSGE-CLWKSDRSAGTLSGYVTLGN 233
            |||. |..|.||:||.:..||.|.:| :|:.::|||||.....: |.:....||...:|:|.:.:
Zfish   195 VDCSRPEGNEGCNGGLMDQAFQYVKDQNGLDSEESYPYLGTDDQPCHFDPKNSAANDTGFVDIPS 259

  Fly   234 YDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGD- 297
            ..||.|.:.:..:|||:|:||..||.|..|..|:.....|.|  ::|.|.||.||:|...:..| 
Zfish   260 GKERALMKAIAAVGPVSVAIDAGHESFQFYQSGIYYEKECSS--EELDHGVLAVGYGFEGEDVDG 322

  Fly   298 --YWIIKNSYGTDWGESGYLKLARNANNMCGVASLPQYP 334
              |||:|||:..:||:.||:.:|::.:|.||:|:...||
Zfish   323 KKYWIVKNSWSENWGDKGYIYMAKDRHNHCGIATAASYP 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 16/58 (28%)
Peptidase_C1A 120..334 CDD:239068 93/219 (42%)
ctslaXP_005165325.1 Inhibitor_I29 55..113 CDD:214853 16/57 (28%)
Peptidase_C1 142..362 CDD:278538 95/223 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.