DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Tinag

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001005549.1 Gene:Tinag / 300846 RGDID:1359482 Length:475 Species:Rattus norvegicus


Alignment Length:272 Identity:76/272 - (27%)
Similarity:119/272 - (43%) Gaps:43/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 FNYRSSI--PAPLETSTNALTETVNYKRYDQITEGI-DWRQYGYISPVGDQGTECLSCWAFSTSG 150
            |.:|...  |:|:..|.|.:  |.:|.|.|.....| .::..|:.....|| ..|.:.|||||:.
  Rat   188 FKFRLGTLPPSPMLLSMNEM--TASYPRADLPEVFIASYKWPGWTHGPLDQ-KNCAASWAFSTAS 249

  Fly   151 VLEAHMA--KKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYTRDHGIATKESYPY---EPV 210
            |....:|  .|......|||::|:.|.....:||:.|.:..|:.:.|..|:.:...||.   :..
  Rat   250 VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWFLRKRGLVSHACYPLFKEQST 314

  Fly   211 SGECLWKSDRSAGTLSGYVT---------------------LGNYDERELAEVVYNIGPVAVSID 254
            :......:.||.|....:.|                     :.:.:...:.|::.| |||. :|.
  Rat   315 NNNSCAMASRSDGRGKRHATRPCPNSFEKSNRIYQCSPPYRISSNETEIMREIIQN-GPVQ-AIM 377

  Fly   255 HLHEEFDQYSGG----VLSIPACRSKRQDL-THSVLLVGFGTHR----KWGDYWIIKNSYGTDWG 310
            .:||:|..|..|    |:|......|.:.| ||:|.|.|:||.|    |...:||..||:|..||
  Rat   378 QVHEDFFYYKTGIYRHVVSTNEEPEKYRKLRTHAVKLTGWGTLRGAQGKKEKFWIAANSWGKSWG 442

  Fly   311 ESGYLKLARNAN 322
            |:||.::.|..|
  Rat   443 ENGYFRILRGVN 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458
Peptidase_C1A 120..334 CDD:239068 66/239 (28%)
TinagNP_001005549.1 Somatomedin_B 61..104 CDD:366428
Peptidase_C1A_CathepsinB 217..465 CDD:239111 66/241 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.