DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctsr

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_783171.2 Gene:Ctsr / 290975 RGDID:631422 Length:334 Species:Rattus norvegicus


Alignment Length:334 Identity:114/334 - (34%)
Similarity:170/334 - (50%) Gaps:20/334 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ILLLLVELGLTAVS---DTEWDQYKAKYNKQYRNRDKYH-RALYEQRVLAVESHNQLYLQGKVAF 73
            ||.|.|..|..|..   |.||..:|.:|.|.|...::.| ||::|:.:..::.||:....||..|
  Rat     9 ILCLGVGSGALAFDPSLDAEWHDWKTEYEKSYTMEEEGHRRAVWEENMKMIKLHNRENSLGKNGF 73

  Fly    74 KMGLNKFSDTDQRILFNYRSSIPAPLETSTNALTETVNYKR--YDQITEGIDWRQYGYISPVGDQ 136
            .|.:|:|.|...........:||.........:.     ||  .:.:.:.:|||:.||::.|.:|
  Rat    74 IMEMNEFGDLTAEEFRKMMVNIPIRSHRKGKIIR-----KRDVGNVLPKFVDWRKKGYVTRVQNQ 133

  Fly   137 GTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCV-PYPNNGCSGGWVSVAFNYTRDH-GI 199
             ..|.|||||:.:|.:|..|..|.|.|.|||.::||||. ...|.||..|...:|:.|..:: |:
  Rat   134 -KFCNSCWAFAVTGAIEGQMFNKTGQLTPLSVQNLVDCTKSQGNEGCQWGDPHIAYEYVLNNGGL 197

  Fly   200 ATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYS 264
            ..:.:|||:...|.|.:....|...::|:|:|.. .|..|.|.|..|||::|::|.....|..|.
  Rat   198 EAEATYPYKGKEGVCRYNPKHSKAEITGFVSLPE-SEDILMEAVATIGPISVAVDASFNSFGFYK 261

  Fly   265 GGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGD---YWIIKNSYGTDWGESGYLKLARNANNMCG 326
            .|:...|.|  ....:.||||:||:|......|   ||:||||:|..||..||:|:.::.||.|.
  Rat   262 KGLYDEPNC--SNNTVNHSVLVVGYGFEGNETDGNSYWLIKNSWGRKWGLRGYMKIPKDQNNFCA 324

  Fly   327 VASLPQYPT 335
            :||...|||
  Rat   325 IASYAHYPT 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 18/55 (33%)
Peptidase_C1A 120..334 CDD:239068 81/218 (37%)
CtsrNP_783171.2 PTZ00203 7..332 CDD:185513 111/331 (34%)
Inhibitor_I29 29..87 CDD:214853 18/57 (32%)
Peptidase_C1A 116..332 CDD:239068 81/219 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.