DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Tinag

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_036163.3 Gene:Tinag / 26944 MGIID:1349477 Length:475 Species:Mus musculus


Alignment Length:284 Identity:77/284 - (27%)
Similarity:119/284 - (41%) Gaps:66/284 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 FNYRSSI--PAPLETSTNALTET------------VNYKRYDQITEGIDWRQYGYISPVGDQGTE 139
            |.:|...  |:|:..|.|.:|.:            .:||          |..:.: .|: || ..
Mouse   187 FKFRLGTLPPSPMLLSMNEMTASFPPRADLPEIFIASYK----------WPGWTH-GPL-DQ-KN 238

  Fly   140 CLSCWAFSTSGVLEAHMA--KKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYTRDHGIATK 202
            |.:.|||||:.|....:|  .|......|||::|:.|.....:||:.|.:..|:.:.|..|:.:.
Mouse   239 CAASWAFSTASVAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWFLRKRGLVSH 303

  Fly   203 ESYP----YEPVSGECLWKSDRSAGTLSGYVT---------------------LGNYDERELAEV 242
            ..||    ....:..|...| ||.|....:.|                     :.:.:...:.|:
Mouse   304 ACYPLFKDQNTTNNICAMAS-RSDGRGKRHATKPCPNSFEKSNRIYQCSPPYRVSSNETEIMREI 367

  Fly   243 VYNIGPVAVSIDHLHEEFDQYSGG----VLSIPACRSKRQDL-THSVLLVGFGTHR----KWGDY 298
            :.| |||. :|..:||:|..|..|    |:|......|.:.| ||:|.|.|:||.|    |...:
Mouse   368 IQN-GPVQ-AIMQVHEDFFYYKTGIYRHVVSTNEEPEKYKKLRTHAVKLTGWGTLRGARGKKEKF 430

  Fly   299 WIIKNSYGTDWGESGYLKLARNAN 322
            ||..||:|..|||:||.::.|..|
Mouse   431 WIAANSWGKSWGENGYFRILRGVN 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458
Peptidase_C1A 120..334 CDD:239068 68/239 (28%)
TinagNP_036163.3 Somatomedin_B 60..103 CDD:279385
VWC 119..>166 CDD:302663
Peptidase_C1A_CathepsinB 217..465 CDD:239111 70/254 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.