DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctsl

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_037288.1 Gene:Ctsl / 25697 RGDID:2448 Length:334 Species:Rattus norvegicus


Alignment Length:348 Identity:123/348 - (35%)
Similarity:193/348 - (55%) Gaps:45/348 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LILLLLVELGLTAVS--------DTEWDQYKAKYNKQY-RNRDKYHRALYEQRVLAVESHNQLYL 67
            |:||.::.|| ||::        :.:|.|:|:.:.:.| .|.:::.||::|:.:..::.||..|.
  Rat     4 LLLLAVLCLG-TALATPKFDQTFNAQWHQWKSTHRRLYGTNEEEWRRAVWEKNMRMIQLHNGEYS 67

  Fly    68 QGKVAFKMGLNKFSDTD----QRILFNYRSS-------IPAPLETSTNALTETVNYKRYDQITEG 121
            .||..|.|.:|.|.|..    ::|:..||..       ...||..               ||.:.
  Rat    68 NGKHGFTMEMNAFGDMTNEEFRQIVNGYRHQKHKKGRLFQEPLML---------------QIPKT 117

  Fly   122 IDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCV-PYPNNGCSGG 185
            :|||:.|.::||.:|| :|.||||||.||.||..|..|.|.|:.||.::||||. ...|.||:||
  Rat   118 VDWREKGCVTPVKNQG-QCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHDQGNQGCNGG 181

  Fly   186 WVSVAFNYTRDH-GIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPV 249
            .:..||.|.::: |:.::||||||...|.|.::::.:....:|:|.:.. .|:.|.:.|..:||:
  Rat   182 LMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEYAVANDTGFVDIPQ-QEKALMKPVATVGPI 245

  Fly   250 AVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGF---GTHRKWGDYWIIKNSYGTDWGE 311
            :|::|..|.....||.|:...|.|.||  ||.|.||:||:   ||......||::|||:|.:||.
  Rat   246 SVAMDASHPSLQFYSSGIYYEPNCSSK--DLDHGVLVVGYGYEGTDSNKDKYWLVKNSWGKEWGM 308

  Fly   312 SGYLKLARNANNMCGVASLPQYP 334
            .||:|:|::.||.||:|:...||
  Rat   309 DGYIKIAKDRNNHCGLATAASYP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 18/59 (31%)
Peptidase_C1A 120..334 CDD:239068 89/218 (41%)
CtslNP_037288.1 Inhibitor_I29 29..87 CDD:214853 18/57 (32%)
Peptidase_C1 114..332 CDD:278538 92/222 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343566
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.