DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctsh

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_037071.1 Gene:Ctsh / 25425 RGDID:2447 Length:333 Species:Rattus norvegicus


Alignment Length:322 Identity:111/322 - (34%)
Similarity:169/322 - (52%) Gaps:20/322 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ELGLTAVSDTEWDQYKAKYNKQYRNRDKYHR-ALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD 82
            ||.:.|:....:..:..::.|.|.:|:..|| .::......:::||    |....||||||:|||
  Rat    22 ELTVNAIEKFHFTSWMKQHQKTYSSREYSHRLQVFANNWRKIQAHN----QRNHTFKMGLNQFSD 82

  Fly    83 TD-QRILFNYRSSIPAPLE-TSTNALTETVNYKRYDQITEGIDWRQYG-YISPVGDQGTECLSCW 144
            .. ..|...|..|.|.... |.:|.|..|..|      ...:|||:.| .:|||.:||. |.|||
  Rat    83 MSFAEIKHKYLWSEPQNCSATKSNYLRGTGPY------PSSMDWRKKGNVVSPVKNQGA-CGSCW 140

  Fly   145 AFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVP-YPNNGCSGGWVSVAFNY-TRDHGIATKESYPY 207
            .|||:|.||:.:|...|.::.|:.:.||||.. :.|:||.||..|.||.| ..:.||..::||||
  Rat   141 TFSTTGALESAVAIASGKMMTLAEQQLVDCAQNFNNHGCQGGLPSQAFEYILYNKGIMGEDSYPY 205

  Fly   208 EPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPA 272
            ...:|:|.:..:::...:...|.:...||..:.|.|....||:.:.: :.|:|..|..||.|..:
  Rat   206 IGKNGQCKFNPEKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFE-VTEDFMMYKSGVYSSNS 269

  Fly   273 CRSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNANNMCGVASLPQYP 334
            |......:.|:||.||:| .:....|||:|||:|::||.:||..:.| ..||||:|:...||
  Rat   270 CHKTPDKVNHAVLAVGYG-EQNGLLYWIVKNSWGSNWGNNGYFLIER-GKNMCGLAACASYP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 17/56 (30%)
Peptidase_C1A 120..334 CDD:239068 80/216 (37%)
CtshNP_037071.1 Inhibitor_I29 33..88 CDD:400519 17/58 (29%)
Peptidase_C1 115..330 CDD:395062 82/219 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.