DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctsc

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_058793.1 Gene:Ctsc / 25423 RGDID:2445 Length:462 Species:Rattus norvegicus


Alignment Length:321 Identity:96/321 - (29%)
Similarity:152/321 - (47%) Gaps:62/321 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RDKYHRALYEQRVLAVESHNQLYLQG-----------------KVAFKMGLNKFSDTDQRILFNY 91
            ::||...||        |||..:::.                 |::.: .|.:.|....|||   
  Rat   160 QEKYSERLY--------SHNHNFVKAINSVQKSWTATTYEEYEKLSIR-DLIRRSGHSGRIL--- 212

  Fly    92 RSSIPAPLETSTNALTETVNYKRYDQITEGIDWRQ---YGYISPVGDQGTECLSCWAFSTSGVLE 153
             ...|||:   |:.:.:.:.     .:.|..|||.   ..::|||.:| ..|.||::|::.|:||
  Rat   213 -RPKPAPI---TDEIQQQIL-----SLPESWDWRNVRGINFVSPVRNQ-ESCGSCYSFASLGMLE 267

  Fly   154 AHMAKKYGN-LVP-LSPKHLVDCVPYPNNGCSGGW-VSVAFNYTRDHGIATKESYPYEPVSGECL 215
            |.:.....| ..| |||:.:|.|.||. .||.||: ..:|..|.:|.|:..:..:||......|.
  Rat   268 ARIRILTNNSQTPILSPQEVVSCSPYA-QGCDGGFPYLIAGKYAQDFGVVEENCFPYTATDAPCK 331

  Fly   216 WKSDRSAGTLSGYVTLGNY----DERELAEVVYNIGPVAVSIDHLHEEFDQYSGGV-----LSIP 271
            .|.:......|.|..:|.:    :|..:...:...||:||:.: :|::|..|..|:     ||.|
  Rat   332 PKENCLRYYSSEYYYVGGFYGGCNEALMKLELVKHGPMAVAFE-VHDDFLHYHSGIYHHTGLSDP 395

  Fly   272 ACRSKRQDLT-HSVLLVGFGTHRKWG-DYWIIKNSYGTDWGESGYLKLARNANNMCGVASL 330
               ....:|| |:|||||:|.....| ||||:|||:|:.||||||.::.|..:. |.:.|:
  Rat   396 ---FNPFELTNHAVLLVGYGKDPVTGLDYWIVKNSWGSQWGESGYFRIRRGTDE-CAIESI 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 10/57 (18%)
Peptidase_C1A 120..334 CDD:239068 79/228 (35%)
CtscNP_058793.1 CathepsinC_exc 25..138 CDD:400909
Pox_I6 168..>204 CDD:333259 6/44 (14%)
Peptidase_C1A_CathepsinC 230..459 CDD:239112 79/230 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.