DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctsq

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_640355.1 Gene:Ctsq / 246147 RGDID:631421 Length:343 Species:Rattus norvegicus


Alignment Length:355 Identity:123/355 - (34%)
Similarity:184/355 - (51%) Gaps:36/355 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TPRLTVVHGLILLLLVELGLTAVS---DTEWDQYKAKYNKQYRNRDK-YHRALYEQRVLAVESHN 63
            ||.:.:|   ||.|.|..|.:|:.   |.:|.::|.||.|.|...:: ..|.::|:.|..:|.||
  Rat     2 TPAVFLV---ILCLGVVPGASALDLSLDVQWQEWKIKYEKLYSPEEEVLKRVVWEENVKKIELHN 63

  Fly    64 QLYLQGKVAFKMGLNKFSD-TDQRILFNYRSSI---PAPLETSTNALTETV---------NYKRY 115
            :....||..:.|.:|.|:| ||:    .::..|   ..|:..:...|.:..         |::  
  Rat    64 RENSLGKNTYTMEINDFADMTDE----EFKDMIIGFQLPVHNTEKRLWKRALGSFFPNSWNWR-- 122

  Fly   116 DQITEGIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDC-VPYPN 179
            |.:.:.:|||..||::.|..|| .|.|||||..:|.:|..|.||.|.|:|||.::|:|| .|..|
  Rat   123 DALPKFVDWRNEGYVTRVRKQG-GCSSCWAFPVTGAIEGQMFKKTGKLIPLSVQNLIDCSKPQGN 186

  Fly   180 NGCSGGWVSVAFNYT-RDHGIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVV 243
            .||..|....||.|. .:.|:..:.:||||...|.|.:....|:..::|:|.|.. .|..|.:.|
  Rat   187 RGCLWGNTYNAFQYVLHNGGLEAEATYPYERKEGVCRYNPKNSSAKITGFVVLPE-SEDVLMDAV 250

  Fly   244 YNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGF---GTHRKWGDYWIIKNSY 305
            ...||:|..:..:...|..|..||...|.|.|.   :.|:||:||:   |......:||:||||:
  Rat   251 ATKGPIATGVHVISSSFRFYQKGVYHEPKCSSY---VNHAVLVVGYGFEGNETDGNNYWLIKNSW 312

  Fly   306 GTDWGESGYLKLARNANNMCGVASLPQYPT 335
            |..||..||:|:|::.||.|.:|||.||||
  Rat   313 GKRWGLRGYMKIAKDRNNHCAIASLAQYPT 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 19/56 (34%)
Peptidase_C1A 120..334 CDD:239068 85/218 (39%)
CtsqNP_640355.1 PTZ00203 4..341 CDD:185513 118/350 (34%)
Inhibitor_I29 29..87 CDD:214853 20/61 (33%)
Peptidase_C1 125..342 CDD:278538 86/221 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.