DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctso

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_808330.1 Gene:Ctso / 229445 MGIID:2139628 Length:312 Species:Mus musculus


Alignment Length:351 Identity:96/351 - (27%)
Similarity:154/351 - (43%) Gaps:75/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRLTVVHGLILLLLVELGLTAVSDT-EWD-QYKAKYNKQYRNRDKYHRALYEQRVLAVESHNQ-- 64
            |:|.   .|:||....||...|:.| .|. |.:|...::..:|.:|..:...:...|....||  
Mouse     3 PQLV---NLLLLCCCCLGRHGVAGTWSWSHQREAAALRESLHRHRYLNSFPHENSTAFYGVNQFS 64

  Fly    65 ---------LYLQGKVAFKMGLNKFSDTDQRILFNYRSSIPAPLETSTNALTETVNYKRYDQITE 120
                     |||..|.|:   ..::....||.:.|    :..||.                    
Mouse    65 YLFPEEFKALYLGSKYAW---APRYPAEGQRPIPN----VSLPLR-------------------- 102

  Fly   121 GIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGG 185
             .|||....::||.:| ..|..|||||....:|:..|.:..:|..||.:.::|| .:.|:||.||
Mouse   103 -FDWRDKHVVNPVRNQ-EMCGGCWAFSVVSAIESARAIQGKSLDYLSVQQVIDC-SFNNSGCLGG 164

  Fly   186 -------WVSVAFNYTRDHGIATKESYPYEPVSGECLWKSDRSAGT----LSGYVTLGNYDEREL 239
                   |:    |.|:...:|..: ||::.|:|:|.......||.    .|.|...|..|  |:
Mouse   165 SPLCALRWL----NETQLKLVADSQ-YPFKAVNGQCRHFPQSQAGVSVKDFSAYNFRGQED--EM 222

  Fly   240 AEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGD--YWIIK 302
            |..:.:.||:.|.:|.:  .:..|.||::. ..|.|  .:..|:||:.||.   :.|:  ||:::
Mouse   223 ARALLSFGPLVVIVDAM--SWQDYLGGIIQ-HHCSS--GEANHAVLITGFD---RTGNTPYWMVR 279

  Fly   303 NSYGTDWGESGYLKLARNANNMCGVA 328
            ||:|:.||..||..: :...|:||:|
Mouse   280 NSWGSSWGVEGYAHV-KMGGNVCGIA 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 13/66 (20%)
Peptidase_C1A 120..334 CDD:239068 69/222 (31%)
CtsoNP_808330.1 Peptidase_C1A 100..305 CDD:239068 71/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.