DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and K02E7.10

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_493904.1 Gene:K02E7.10 / 186889 WormBaseID:WBGene00019314 Length:299 Species:Caenorhabditis elegans


Alignment Length:249 Identity:74/249 - (29%)
Similarity:118/249 - (47%) Gaps:27/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PLETSTNALTETVNYK---RYDQITEGIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAK- 158
            |.:..|:.......|:   .:....:.:|||:.|.:.||.||| :|.:.:||:....:|:..|| 
 Worm    57 PYQPKTSETPRPPQYQTKLSHHMTQDFLDWREKGIVGPVKDQG-KCNASYAFAAIAAIESMYAKA 120

  Fly   159 KYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFN-YTRDHGIATKESYPY---EPVSGECLWKSD 219
            ..|.|:..|.:.::||..: .|.|.....:|..| :.:::|:.|:..|||   |.| |:|.:.|.
 Worm   121 NNGKLLSFSEQQIIDCANF-TNPCQENLENVLSNRFLKENGVGTEADYPYVGKENV-GKCEYDSS 183

  Fly   220 RSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHE--EFDQYSGGVLSIPACRSKRQDLTH 282
            :.. ....|:.:  |...|.|..  :|.........:..  .|..|..|:.:.........:...
 Worm   184 KMK-LRPTYIDV--YPNEEWARA--HITTFGTGYFRMRSPPSFFHYKTGIYNPTKEECGNANEAR 243

  Fly   283 SVLLVGFGTHRKWG--DYWIIKNSYGTDWGESGYLKLARNANNMCGVA---SLP 331
            |:.:||:|   |.|  .|||:|.|:||.|||.||:|||||. |.||:|   |:|
 Worm   244 SLAIVGYG---KDGAEKYWIVKGSFGTSWGEHGYMKLARNV-NACGMAESISIP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458
Peptidase_C1A 120..334 CDD:239068 71/224 (32%)
K02E7.10NP_493904.1 Peptidase_C1A 82..293 CDD:239068 70/222 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161091
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.820

Return to query results.
Submit another query.