DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and cpr-2

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_507186.3 Gene:cpr-2 / 185355 WormBaseID:WBGene00000782 Length:326 Species:Caenorhabditis elegans


Alignment Length:242 Identity:74/242 - (30%)
Similarity:109/242 - (45%) Gaps:41/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 WRQYGYISPVGDQGTECLSCWAFSTSGVL-EAHMAKKYGNLVP-LSPKHLVDCVPYP-NNGCSGG 185
            |.|...:..:.:| :.|.|||||||:.|: :.......|...| :||..|:.|.... ..||.||
 Worm    93 WPQCKSMKLIREQ-SNCGSCWAFSTAEVISDRTCIASNGTQQPIISPTDLLTCCGMSCGEGCDGG 156

  Fly   186 WVSVAFNYTRDHGIATK--------ESYPYEPV-SGECL------WKSDRSAGTLSGYVTLGNYD 235
            :...||.:....|:.|.        :.||..|. |..|:      .:.....|..:.|....||.
 Worm   157 FPYRAFQWWARRGVVTGGDYLGTGCKPYPIRPCNSDNCVNLQTPPCRLSCQPGYRTTYTNDKNYG 221

  Fly   236 EREL----------AEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFG 290
            ....          |::.|| ||| |:...::|:|::|..|:....|.|||.   .|:|.|:|:|
 Worm   222 NSAYPVPRTVAAIQADIYYN-GPV-VAAFIVYEDFEKYKSGIYRHIAGRSKG---GHAVKLIGWG 281

  Fly   291 THRKWGDYWIIKNSYGTDWGESGYLKLARNANNMCG-----VASLPQ 332
            |.| ...||:..||:|:.|||||..::.|..:. ||     ||.||:
 Worm   282 TER-GTPYWLAVNSWGSQWGESGTFRILRGVDE-CGIESRIVAGLPR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458
Peptidase_C1A 120..334 CDD:239068 74/242 (31%)
cpr-2NP_507186.3 Peptidase_C1A_CathepsinB 84..323 CDD:239111 71/237 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161045
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.