DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and F15D4.4

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_496805.3 Gene:F15D4.4 / 184530 WormBaseID:WBGene00008861 Length:608 Species:Caenorhabditis elegans


Alignment Length:302 Identity:91/302 - (30%)
Similarity:138/302 - (45%) Gaps:63/302 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LYEQRVLAVESHNQLYLQGKVAFKMGLNKFS-DTDQRILFNYRSSIPAPLETSTNALTETVNY-- 112
            :|.:....|:.||.:|..|..::||..|:|| ..|..:         |||..:.:|||.|...  
 Worm   157 VYSKVKKEVDEHNIMYELGMSSYKMSTNQFSVALDGEV---------APLTLNLDALTPTATVIP 212

  Fly   113 ----KRYDQITE-GIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLV 172
                .|..:.|| .:|||.  ::.|:.||.| |..|||||...::|:..|.:..|...||.:.|:
 Worm   213 ATISSRKKRDTEPTVDWRP--FLKPILDQST-CGGCWAFSMISMIESFFAIQGYNTSSLSVQQLL 274

  Fly   173 DC-------VPYPNNGCSGGWVSVAFNY-----TRDHGI-------ATKESYPYEPVSGECLWKS 218
            .|       ....|.||.||:..:|.:|     .||..:       .:.:|..:.||....|...
 Worm   275 TCDTKVDSTYGLANVGCKGGYFQIAGSYLEVSAARDASLIPFDLEDTSCDSSFFPPVVPTILLFD 339

  Fly   219 DRSAGTLSGYVTLGNYDERELAEVVYNI------GPVAVSIDHLHEEFDQYSGGVLSIPACRSKR 277
            |       ||:: ||:...:|..:..||      ||:||.: ....:..:||.||.. ..|.:  
 Worm   340 D-------GYIS-GNFTAAQLITMEQNIEDKVRKGPIAVGM-AAGPDIYKYSEGVYD-GDCGT-- 392

  Fly   278 QDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLAR 319
             .:.|:|::|||     ..|||||:||:|..|||:||.::.|
 Worm   393 -IINHAVVIVGF-----TDDYWIIRNSWGASWGEAGYFRVKR 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 11/34 (32%)
Peptidase_C1A 120..334 CDD:239068 70/226 (31%)
F15D4.4NP_496805.3 Inhibitor_I29 <146..187 CDD:214853 9/29 (31%)
Peptidase_C1A 227..442 CDD:239068 69/223 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.