DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and C32B5.13

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_493866.1 Gene:C32B5.13 / 183116 WormBaseID:WBGene00016306 Length:150 Species:Caenorhabditis elegans


Alignment Length:162 Identity:37/162 - (22%)
Similarity:67/162 - (41%) Gaps:22/162 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 MAKKYGN--LVPLSPKHLVDCVPYPNNGCSGGWVS------VAFNYTRDHGIATKESYPYEPVSG 212
            |..|..|  ::..|.:.::||         |.:.|      ::..:.:.:|:.|:..|||.....
 Worm     1 MYAKANNRTVLSFSEQQIIDC---------GNFTSPCQENILSHEFIKKNGVVTEADYPYVGKEN 56

  Fly   213 E-CLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSK 276
            | |.:..::.....:..:.:||..|..|...:...||....: .....|..|..|:.|.......
 Worm    57 EKCKYDENKIKLWPTNMLLVGNLPETLLKLFIKEHGPGYFRM-KAPPSFFNYKTGIYSPTQEECG 120

  Fly   277 RQDLTHSVLLVGFGTHRKWG-DYWIIKNSYGT 307
            :.....|:.:||:|.  :.| :|||:|.|:||
 Worm   121 KATDARSLTIVGYGI--EGGQNYWIVKGSFGT 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458
Peptidase_C1A 120..334 CDD:239068 37/162 (23%)
C32B5.13NP_493866.1 Peptidase_C1 1..150 CDD:390061 35/160 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161090
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.