DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and C32B5.7

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001293573.1 Gene:C32B5.7 / 183111 WormBaseID:WBGene00016300 Length:234 Species:Caenorhabditis elegans


Alignment Length:239 Identity:68/239 - (28%)
Similarity:107/239 - (44%) Gaps:45/239 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PAPLETSTN--------ALT----------ETVNYKRYDQITEGIDWRQYGYISPVGDQGTECLS 142
            ||.|..:.|        |||          .|.|||...:  ..:|||..|.:.||.||| .|.:
 Worm    14 PANLRNTRNYIGLFLLTALTFYIIGALVQQRTQNYKNAKK--PFLDWRDEGVVGPVKDQG-NCNA 75

  Fly   143 CWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCS-GGWVSVAFNYTRDHGIATKESYP 206
            .:||:....:|:..|...|.|:..|.:.::||:    .||: .....:|..|....||.|...||
 Worm    76 SYAFAAISAIESMYAIANGQLLSFSEQQIIDCL----GGCAIESDPMMAMTYLERKGIETYTDYP 136

  Fly   207 YEPVSGE-CLWKSDRSAGTLSGYVTLGN-YD--ERELAEV-VYNIGPVAVSIDHLHEEFDQYSGG 266
            :.....| |.:.|.::      |:.|.: ||  :..||.| :...||...:: :....|..|..|
 Worm   137 FVGKKNEKCEYDSKKA------YLILDDTYDMSDESLALVFIDERGPGLFTM-NTPPSFFNYKSG 194

  Fly   267 VLSIPA---CRSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGT 307
            :.: |.   |:|..:  ..::.:||:| :.|..:|||:|.|:||
 Worm   195 IYN-PTEEECKSTNE--KRALTIVGYG-NDKGQNYWIVKGSFGT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458
Peptidase_C1A 120..334 CDD:239068 57/197 (29%)
C32B5.7NP_001293573.1 Peptidase_C1A 56..234 CDD:239068 55/193 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.