DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Y51A2D.1

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001256811.1 Gene:Y51A2D.1 / 180204 WormBaseID:WBGene00013072 Length:314 Species:Caenorhabditis elegans


Alignment Length:339 Identity:77/339 - (22%)
Similarity:116/339 - (34%) Gaps:122/339 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EWDQYKAKYNKQYRNRDKYHRALYEQRVLAVESHNQLYLQ------------GKVAFKMG----- 76
            |:.::|.|:::.|::                |:.|||.||            .|.|.|.|     
 Worm    43 EFVEFKKKFSRTYKS----------------EAENQLRLQNFVKSRNNVVRLNKNAQKAGRNSNF 91

  Fly    77 -LNKFSDTDQRILFNYRSSIPAPLETST-------NALTETVNYKRYDQITEGIDWR------QY 127
             :|:|||.....|....|..|..|..::       ..|.:|...::..:.....|.|      :|
 Worm    92 AVNQFSDLTTSELHQRLSRFPPNLTENSVFHKNFKKLLGKTRTKRQNSEFARNFDLRSQKVNGRY 156

  Fly   128 GYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFN 192
             .:.|:.:|| :|..||.|:.:.:||...|...|.                            |.
 Worm   157 -IVGPIKNQG-QCACCWGFAVTAMLETIYAVNVGR----------------------------FK 191

  Fly   193 YTRDHGIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLH 257
            ...|:.....|:...|.:.....||:                             ||||.. ...
 Worm   192 RKLDYHFIRPENAESEIIEILNTWKT-----------------------------PVAVYF-AAG 226

  Fly   258 EEFDQYSGGVLSIPACRSKRQDLT----HSVLLVGFGTHR----KWGDYWIIKNSYG-TDWGESG 313
            ..|.||..|||....|     ||.    |:..:||:|...    :...:||:|||:| :.||..|
 Worm   227 TAFLQYKSGVLVTEDC-----DLAGTVWHAGAIVGYGEENDLRGRSQRFWIMKNSWGVSGWGTGG 286

  Fly   314 YLKLARNANNMCGV 327
            |:||.| ..|.||:
 Worm   287 YVKLIR-GKNWCGI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 17/72 (24%)
Peptidase_C1A 120..334 CDD:239068 53/223 (24%)
Y51A2D.1NP_001256811.1 Inhibitor_I29 44..103 CDD:214853 17/74 (23%)
Peptidase_C1A 144..303 CDD:239068 53/222 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161058
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.