DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and cpz-2

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_506318.1 Gene:cpz-2 / 179818 WormBaseID:WBGene00000789 Length:467 Species:Caenorhabditis elegans


Alignment Length:315 Identity:83/315 - (26%)
Similarity:134/315 - (42%) Gaps:65/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KAKYNKQYRNRDKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSDTDQRILFNYRSSIPAP 98
            |||..|.|  .:....||.:....:.||..: :.:.:...|.|..|.|..    :|..::   ||
 Worm   154 KAKLEKGY--YEPNDEALVDMSSESEESSEE-WEEARPYLKCGCLKKSGK----VFESKT---AP 208

  Fly    99 LETSTNALTETVNYKRYDQITEGIDWRQ---YGYISPVGDQ--GTECLSCWAFSTSGVL--EAHM 156
            .|      .|:.::|..| :..|.|||.   ..|.||..:|  ...|.|||.|.|:|.|  ..::
 Worm   209 RE------WESSSFKSND-LPTGWDWRNVSGVNYCSPTRNQHIPVYCGSCWVFGTTGALNDRFNV 266

  Fly   157 AKKYGN--LVPLSPKHLVDCVPYPNNG---CSGGWVSVAFNYTRDHGIATKESYPYEPVSGEC-- 214
            |:| |.  :..|||:.::||     ||   |.||.:.....:.:..|:..:....|...:|||  
 Worm   267 ARK-GRWPMTQLSPQEIIDC-----NGKGNCQGGEIGNVLEHAKIQGLVEEGCNVYRATNGECNP 325

  Fly   215 ------LWKSDRSAGTLSGYVTLGNYDERELAEV---------VYNIGPVAVSIDHLHEEFDQYS 264
                  .|.::  ..:|:.|.   .|..::..:|         :...||:|.:|....:...:|.
 Worm   326 YHRCGSCWPNE--CFSLTNYT---RYYVKDYGQVQGRDKIMSEIKKGGPIACAIGATKKFEYEYV 385

  Fly   265 GGVLSIPACRSKRQDL--THSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKL 317
            .||.      |::.||  .|.:.|.|:|......:|||.:||:|..|||.|:.::
 Worm   386 KGVY------SEKSDLESNHIISLTGWGVDENGVEYWIARNSWGEAWGELGWFRV 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 13/50 (26%)
Peptidase_C1A 120..334 CDD:239068 63/229 (28%)
cpz-2NP_506318.1 Peptidase_C1A_CathepsinX 221..461 CDD:239149 63/231 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.