DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and cpr-1

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_506002.2 Gene:cpr-1 / 179637 WormBaseID:WBGene00000781 Length:329 Species:Caenorhabditis elegans


Alignment Length:295 Identity:78/295 - (26%)
Similarity:126/295 - (42%) Gaps:64/295 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KVAFKMGLNKF----SD----TDQRILFNYRSSIPAPLETSTNALTETVNYKRYDQITEGIDWRQ 126
            ::.||:...|:    ||    |:|.::.   :|:||..::.|                   .|.:
 Worm    55 EMKFKLMDGKYAAAHSDEIRATEQEVVL---ASVPATFDSRT-------------------QWSE 97

  Fly   127 YGYISPVGDQGTECLSCWAFSTSGVL-EAHMAKKYGNLVP-LSPKHLVDCVPYP-NNGCSGGWVS 188
            ...|..:.||.| |.|||||..:.:: :....:..|...| :||..|:.|.... .|||.||:..
 Worm    98 CKSIKLIRDQAT-CGSCWAFGAAEMISDRTCIETKGAQQPIISPDDLLSCCGSSCGNGCEGGYPI 161

  Fly   189 VAFNYTRDHGIATK--------ESYPYEP-VSGECLWKSDRSA--GTLSGYVTLGNYDE------ 236
            .|..:....|:.|.        :.||..| .||.|......|.  ...|||.|....|:      
 Worm   162 QALRWWDSKGVVTGGDYHGAGCKPYPIAPCTSGNCPESKTPSCSMSCQSGYSTAYAKDKHFGVSA 226

  Fly   237 ----RELAEV---VYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRK 294
                :..|.:   :|..|||..:.. ::|:|.:|..||....|.:...   .|::.::|:|| ..
 Worm   227 YAVPKNAASIQAEIYANGPVEAAFS-VYEDFYKYKSGVYKHTAGKYLG---GHAIKIIGWGT-ES 286

  Fly   295 WGDYWIIKNSYGTDWGESGYLKLARNANNMCGVAS 329
            ...||::.||:|.:|||||:.|:.| .::.||:.|
 Worm   287 GSPYWLVANSWGVNWGESGFFKIYR-GDDQCGIES 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 6/22 (27%)
Peptidase_C1A 120..334 CDD:239068 67/237 (28%)
cpr-1NP_506002.2 Peptidase_C1A_CathepsinB 86..325 CDD:239111 70/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161048
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.