DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and cpr-4

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_504682.1 Gene:cpr-4 / 179053 WormBaseID:WBGene00000784 Length:335 Species:Caenorhabditis elegans


Alignment Length:282 Identity:71/282 - (25%)
Similarity:112/282 - (39%) Gaps:61/282 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 RSSIPAPLETSTNALTETVNYKRYDQITEGID----WRQYGYISPVGDQGTECLSCWAFSTSGVL 152
            |:...||.......:...:|   .|.|....|    |.....|:.:.|| ::|.|||||:.:...
 Worm    58 RTEFVAPHTPDVEVVKHDIN---EDTIPATFDARTQWPNCMSINNIRDQ-SDCGSCWAFAAAEAA 118

  Fly   153 EAHMAKKYGNLVP--LSPKHLVDCVPYPNNGCSGGWVSVAFNYTRDHGIATKESY-------PY- 207
            ...........|.  ||.:.::.|......||.||:...|:.|....|..|..||       || 
 Worm   119 SDRFCIASNGAVNTLLSAEDVLSCCSNCGYGCEGGYPINAWKYLVKSGFCTGGSYEAQFGCKPYS 183

  Fly   208 -----EPVSGECLWKS--------------------------DRSAGTLSGYVTLGNYDERELAE 241
                 |.| |...|.|                          |:..|:.:  ..:|....:..||
 Worm   184 LAPCGETV-GNVTWPSCPDDGYDTPACVNKCTNKNYNVAYTADKHFGSTA--YAVGKKVSQIQAE 245

  Fly   242 VVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDL-THSVLLVGFGTHRKWGDYWIIKNSY 305
            ::.: |||..:.. ::|:|.||..||.    ..:..|:| .|::.::|:||. ....||::.||:
 Worm   246 IIAH-GPVEAAFT-VYEDFYQYKTGVY----VHTTGQELGGHAIRILGWGTD-NGTPYWLVANSW 303

  Fly   306 GTDWGESGYLKLARNANNMCGV 327
            ..:|||:||.::.|..|. ||:
 Worm   304 NVNWGENGYFRIIRGTNE-CGI 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458
Peptidase_C1A 120..334 CDD:239068 65/254 (26%)
cpr-4NP_504682.1 Peptidase_C1A_CathepsinB 82..331 CDD:239111 65/255 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161075
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.