DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and cpr-8

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_503384.1 Gene:cpr-8 / 178613 WormBaseID:WBGene00021070 Length:335 Species:Caenorhabditis elegans


Alignment Length:321 Identity:75/321 - (23%)
Similarity:131/321 - (40%) Gaps:88/321 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SDTDQRILF------NYRSSIPAPLETSTNALTETVNYKRYDQITEGIDWRQYGY------ISPV 133
            |:.|:.|.:      .:.:.|||   .|.|::.:|:   ..|..|.|...:.:|.      :||.
 Worm    21 SEIDRIIHYVNSQKTTWTAGIPA---LSRNSMLKTL---VTDAATIGFKIQNFGVSQANSDLSPS 79

  Fly   134 GDQG---------------TECLSCWAFSTSGVLEAHMAKKYG---NLVPLSPKHLVDCVP---Y 177
            .|..               :||.:.|||:.:..:...:....|   |.: ||.:.|:.|..   .
 Worm    80 FDARERWPECMSIPQINDISECKTSWAFAAAESMSDRLCINSGGFKNTI-LSAEELLSCCTGMFS 143

  Fly   178 PNNGCSGGWVSVAFNYTRDHGIATKESY-------PYE-PVSGECLW---------------KSD 219
            ...||.||....|:.|.:.|||.|..||       ||. |..|:.:.               ..:
 Worm   144 CGEGCEGGNPFKAWQYIQKHGIPTGGSYESQFGCKPYSIPPCGKTVGNVTYPACTNTTSPTPSCE 208

  Fly   220 RSAGTLSGY-----------VTLGNYDEREL---AEVVYNIGPVAVSIDHLHEEFDQYSGGVLSI 270
            :...:..||           |::......::   ::|:.| ||:..:.: ::::|.||:.|:. :
 Worm   209 KKCTSRIGYPIDIDKDRHYGVSVDQLPNSQIEIQSDVMLN-GPIQATFE-VYDDFLQYTTGIY-V 270

  Fly   271 PACRSKRQDLTHSVLLVGFGTHRKWG--DYWIIKNSYGTDWGESGYLKLARNANNMCGVAS 329
            ....:|:..|  ||.::|:|.   |.  .||:..||:|..|||:|..::.|..|. ||:.|
 Worm   271 HLTGNKQGHL--SVRIIGWGV---WQGVPYWLCANSWGRQWGENGTFRVLRGTNE-CGLES 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 1/3 (33%)
Peptidase_C1A 120..334 CDD:239068 64/276 (23%)
cpr-8NP_503384.1 Propeptide_C1 24..>40 CDD:369701 2/15 (13%)
Peptidase_C1A_CathepsinB 79..330 CDD:239111 60/257 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.