DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and CTSW

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001326.3 Gene:CTSW / 1521 HGNCID:2546 Length:376 Species:Homo sapiens


Alignment Length:337 Identity:94/337 - (27%)
Similarity:156/337 - (46%) Gaps:61/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YKAKYNKQYRNRDKY-HRALYEQRVLAVESHNQLYLQ-------GKVAFKMGLNKFSD-TDQRI- 87
            ::.::|:.|.:.::: ||       |.:.:||....|       |...|  |:..||| |::.. 
Human    45 FQIQFNRSYLSPEEHAHR-------LDIFAHNLAQAQRLQEEDLGTAEF--GVTPFSDLTEEEFG 100

  Fly    88 -LFNYR---SSIPA-PLETSTNALTETVNYKRYDQITEGIDWRQY-GYISPVGDQGTECLSCWAF 146
             |:.||   ..:|: ..|..:....|:|.:        ..|||:. ..|||:.|| ..|..|||.
Human   101 QLYGYRRAAGGVPSMGREIRSEEPEESVPF--------SCDWRKVASAISPIKDQ-KNCNCCWAM 156

  Fly   147 STSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAF-NYTRDHGIATKESYPYEPV 210
            :.:|.:|......:.:.|.:|.:.|:|| ....:||.||:|..|| ....:.|:|:::.||::..
Human   157 AAAGNIETLWRISFWDFVDVSVQELLDC-GRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGK 220

  Fly   211 --SGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPAC 273
              :..|..|..:....:..::.|.| :|..:|:.:...||:.|:|:  .:....|..||:.....
Human   221 VRAHRCHPKKYQKVAWIQDFIMLQN-NEHRIAQYLATYGPITVTIN--MKPLQLYRKGVIKATPT 282

  Fly   274 RSKRQDLTHSVLLVGFGTHRK----WGD---------------YWIIKNSYGTDWGESGYLKLAR 319
            ....|.:.|||||||||:.:.    |.:               |||:|||:|..|||.||.:|.|
Human   283 TCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHR 347

  Fly   320 NANNMCGVASLP 331
            .:|. ||:...|
Human   348 GSNT-CGITKFP 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 15/60 (25%)
Peptidase_C1A 120..334 CDD:239068 72/235 (31%)
CTSWNP_001326.3 Inhibitor_I29 42..98 CDD:214853 15/61 (25%)
Peptidase_C1A 129..358 CDD:239068 71/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.