DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and CTSO

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001325.1 Gene:CTSO / 1519 HGNCID:2542 Length:321 Species:Homo sapiens


Alignment Length:327 Identity:92/327 - (28%)
Similarity:145/327 - (44%) Gaps:74/327 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WDQYKAKYNKQYR---NRDKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSDTDQRILFN- 90
            |.:.:.:....:|   ||.:|..:|:..             :...|| .|:|:||     .||. 
Human    33 WPRSREREAAAFRESLNRHRYLNSLFPS-------------ENSTAF-YGINQFS-----YLFPE 78

  Fly    91 -----YRSSIPAPLETSTNALTETVNYKRYD----------QITEGIDWRQYGYISPVGDQGTEC 140
                 |..|.|:             .:.||.          .:....|||....::.|.:| ..|
Human    79 EFKAIYLRSKPS-------------KFPRYSAEVHMSIPNVSLPLRFDWRDKQVVTQVRNQ-QMC 129

  Fly   141 LSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYTRDHGI-ATKES 204
            ..|||||..|.:|:..|.|...|..||.:.::|| .|.|.||:||....|.|:.....: ..|:|
Human   130 GGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDC-SYNNYGCNGGSTLNALNWLNKMQVKLVKDS 193

  Fly   205 -YPYEPVSGECLWKSDRSAG-TLSGYVTLGNYD----ERELAEVVYNIGPVAVSIDHLHEEFDQY 263
             ||::..:|.|.:.|...:| ::.||   ..||    |.|:|:.:...||:.|.:|.:  .:..|
Human   194 EYPFKAQNGLCHYFSGSHSGFSIKGY---SAYDFSDQEDEMAKALLTFGPLVVIVDAV--SWQDY 253

  Fly   264 SGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGD--YWIIKNSYGTDWGESGYLKLARNANNMCG 326
            .||::. ..|.|  .:..|:||:.||.   |.|.  |||::||:|:.||..||..: :..:|:||
Human   254 LGGIIQ-HHCSS--GEANHAVLITGFD---KTGSTPYWIVRNSWGSSWGVDGYAHV-KMGSNVCG 311

  Fly   327 VA 328
            :|
Human   312 IA 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 12/57 (21%)
Peptidase_C1A 120..334 CDD:239068 73/218 (33%)
CTSONP_001325.1 Peptidase_C1A 109..319 CDD:239068 73/219 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.