DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and CTSV

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001188504.1 Gene:CTSV / 1515 HGNCID:2538 Length:334 Species:Homo sapiens


Alignment Length:325 Identity:116/325 - (35%)
Similarity:182/325 - (56%) Gaps:35/325 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DTEWDQYKAKYNKQY-RNRDKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD-TDQRI-- 87
            ||:|.|:||.:.:.| .|.:.:.||::|:.:..:|.||..|.|||..|.|.:|.|.| |::..  
Human    26 DTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQ 90

  Fly    88 --------LFNYRSSIPAPLETSTNALTETVNYKRYDQITEGIDWRQYGYISPVGDQGTECLSCW 144
                    .|........||               :..:.:.:|||:.||::||.:| .:|.|||
Human    91 MMGCFRNQKFRKGKVFREPL---------------FLDLPKSVDWRKKGYVTPVKNQ-KQCGSCW 139

  Fly   145 AFSTSGVLEAHMAKKYGNLVPLSPKHLVDCV-PYPNNGCSGGWVSVAFNYTRDH-GIATKESYPY 207
            |||.:|.||..|.:|.|.||.||.::||||. |..|.||:||:::.||.|.::: |:.::|||||
Human   140 AFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPY 204

  Fly   208 EPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPA 272
            ..|...|.::.:.|....:|:..:....|:.|.:.|..:||::|::|..|..|..|..|:...|.
Human   205 VAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPD 269

  Fly   273 CRSKRQDLTHSVLLVGF---GTHRKWGDYWIIKNSYGTDWGESGYLKLARNANNMCGVASLPQYP 334
            |.||  :|.|.||:||:   |.:.....||::|||:|.:||.:||:|:|::.||.||:|:...||
Human   270 CSSK--NLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYP 332

  Fly   335  334
            Human   333  332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 22/56 (39%)
Peptidase_C1A 120..334 CDD:239068 87/218 (40%)
CTSVNP_001188504.1 Inhibitor_I29 29..87 CDD:214853 22/57 (39%)
Peptidase_C1 114..332 CDD:306594 87/220 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149672
Domainoid 1 1.000 49 1.000 Domainoid score I11780
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.