DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and CTSL

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001244900.1 Gene:CTSL / 1514 HGNCID:2537 Length:333 Species:Homo sapiens


Alignment Length:340 Identity:121/340 - (35%)
Similarity:193/340 - (56%) Gaps:29/340 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ILLLLVELGLTAVS-------DTEWDQYKAKYNKQY-RNRDKYHRALYEQRVLAVESHNQLYLQG 69
            ::|....||:.:.:       :.:|.::||.:|:.| .|.:.:.||::|:.:..:|.|||.|.:|
Human     5 LILAAFCLGIASATLTFDHSLEAQWTKWKAMHNRLYGMNEEGWRRAVWEKNMKMIELHNQEYREG 69

  Fly    70 KVAFKMGLNKFSDTD----QRILFNYRSSIPAPLETSTNALTETVNYKRYDQITEGIDWRQYGYI 130
            |.:|.|.:|.|.|..    ::::..:::..|    .......|.:.|    :....:|||:.||:
Human    70 KHSFTMAMNAFGDMTSEEFRQVMNGFQNRKP----RKGKVFQEPLFY----EAPRSVDWREKGYV 126

  Fly   131 SPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCV-PYPNNGCSGGWVSVAFNYT 194
            :||.:|| :|.||||||.:|.||..|.:|.|.|:.||.::||||. |..|.||:||.:..||.|.
Human   127 TPVKNQG-QCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYV 190

  Fly   195 RDH-GIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHE 258
            :|: |:.::||||||.....|.:....|....:|:|.:.. .|:.|.:.|..:||::|:||..||
Human   191 QDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPK-QEKALMKAVATVGPISVAIDAGHE 254

  Fly   259 EFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGD---YWIIKNSYGTDWGESGYLKLARN 320
            .|..|..|:...|.|.|  :|:.|.||:||:|......|   ||::|||:|.:||..||:|:|::
Human   255 SFLFYKEGIYFEPDCSS--EDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKD 317

  Fly   321 ANNMCGVASLPQYPT 335
            ..|.||:||...|||
Human   318 RRNHCGIASAASYPT 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 21/59 (36%)
Peptidase_C1A 120..334 CDD:239068 91/218 (42%)
CTSLNP_001244900.1 Inhibitor_I29 29..87 CDD:214853 21/57 (37%)
Peptidase_C1 114..332 CDD:395062 92/221 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149671
Domainoid 1 1.000 49 1.000 Domainoid score I11780
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.