DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and CTSK

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_000387.1 Gene:CTSK / 1513 HGNCID:2536 Length:329 Species:Homo sapiens


Alignment Length:332 Identity:120/332 - (36%)
Similarity:188/332 - (56%) Gaps:15/332 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GLILLLL--VELGL--TAVSDTEWDQYKAKYNKQYRNR-DKYHRAL-YEQRVLAVESHNQLYLQG 69
            ||.:|||  |...|  ..:.||.|:.:|..:.|||.|: |:..|.| :|:.:..:..||.....|
Human     3 GLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLG 67

  Fly    70 KVAFKMGLNKFSDTDQRILFNYRSSIPAPLETSTNALTETVNYKRYD-QITEGIDWRQYGYISPV 133
            ...:::.:|...|.....:....:.:..||..|.:  .:|:....:: :..:.:|:|:.||::||
Human    68 VHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRS--NDTLYIPEWEGRAPDSVDYRKKGYVTPV 130

  Fly   134 GDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYT-RDH 197
            .:|| :|.||||||:.|.||..:.||.|.|:.|||::|||||. .|:||.||:::.||.|. ::.
Human   131 KNQG-QCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVS-ENDGCGGGYMTNAFQYVQKNR 193

  Fly   198 GIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQ 262
            ||.::::|||......|::.....|....||..:...:|:.|...|..:|||:|:||.....|..
Human   194 GIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQF 258

  Fly   263 YSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNANNMCGV 327
            ||.||....:|.|  .:|.|:||.||:|. :|...:||||||:|.:||..||:.:|||.||.||:
Human   259 YSKGVYYDESCNS--DNLNHAVLAVGYGI-QKGNKHWIIKNSWGENWGNKGYILMARNKNNACGI 320

  Fly   328 ASLPQYP 334
            |:|..:|
Human   321 ANLASFP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 15/56 (27%)
Peptidase_C1A 120..334 CDD:239068 91/214 (43%)
CTSKNP_000387.1 Inhibitor_I29 26..85 CDD:214853 15/58 (26%)
Peptidase_C1 115..327 CDD:306594 91/216 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.