DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and CTSH

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_004381.2 Gene:CTSH / 1512 HGNCID:2535 Length:335 Species:Homo sapiens


Alignment Length:323 Identity:109/323 - (33%)
Similarity:166/323 - (51%) Gaps:22/323 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ELGLTAVSDTEWDQYKAKYNKQYRNRDKYHR-ALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD 82
            ||.:.::....:..:.:|:.|.|...:.:|| ..:......:.:||    .|...|||.||:|||
Human    24 ELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHN----NGNHTFKMALNQFSD 84

  Fly    83 TD-QRILFNYRSSIPAPLE-TSTNALTETVNYKRYDQITEGIDWRQYG-YISPVGDQGTECLSCW 144
            .. ..|...|..|.|.... |.:|.|..|..|      ...:|||:.| ::|||.:||. |.|||
Human    85 MSFAEIKHKYLWSEPQNCSATKSNYLRGTGPY------PPSVDWRKKGNFVSPVKNQGA-CGSCW 142

  Fly   145 AFSTSGVLEAHMAKKYGNLVPLSPKHLVDCV-PYPNNGCSGGWVSVAFNY-TRDHGIATKESYPY 207
            .|||:|.||:.:|...|.::.|:.:.||||. .:.|:||.||..|.||.| ..:.||..:::|||
Human   143 TFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPY 207

  Fly   208 EPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPA 272
            :...|.|.::..::.|.:.....:..|||..:.|.|....||:.:.: :.::|..|..|:.|..:
Human   208 QGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFE-VTQDFMMYRTGIYSSTS 271

  Fly   273 CRSKRQDLTHSVLLVGFGTHRKWG-DYWIIKNSYGTDWGESGYLKLARNANNMCGVASLPQYP 334
            |......:.|:||.||:|  .|.| .|||:|||:|..||.:||..:.| ..||||:|:...||
Human   272 CHKTPDKVNHAVLAVGYG--EKNGIPYWIVKNSWGPQWGMNGYFLIER-GKNMCGLAACASYP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 16/56 (29%)
Peptidase_C1A 120..334 CDD:239068 80/217 (37%)
CTSHNP_004381.2 Inhibitor_I29 35..90 CDD:285458 16/58 (28%)
Peptidase_C1 117..332 CDD:278538 82/220 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.