DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctsw

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_034115.2 Gene:Ctsw / 13041 MGIID:1338045 Length:371 Species:Mus musculus


Alignment Length:363 Identity:104/363 - (28%)
Similarity:166/363 - (45%) Gaps:64/363 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ILLLLVELGLTAVSDTE------------WDQYKAKYNKQYRNRDKYHRALYEQRVLAVESHNQL 65
            ::|||...||:....|:            :..::.::|:.|.|..:|.|.      |::.:||..
Mouse    11 LVLLLAGQGLSDSLLTKDAGPRPLELKEVFKLFQIRFNRSYWNPAEYTRR------LSIFAHNLA 69

  Fly    66 YLQ-------GKVAFKMGLNKFSDTDQRILFNYRSSIPAPLETSTNALTETVNYKRY-DQITEGI 122
            ..|       |...|  |...|||..:...........:|..|..  :|:.|....: :.:....
Mouse    70 QAQRLQQEDLGTAEF--GETPFSDLTEEEFGQLYGQERSPERTPN--MTKKVESNTWGESVPRTC 130

  Fly   123 DWRQ-YGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGW 186
            |||: ...||.|.:||: |..|||.:.:..::|....|:...|.:|.:.|:|| ....|||:||:
Mouse   131 DWRKAKNIISSVKNQGS-CKCCWAMAAADNIQALWRIKHQQFVDVSVQELLDC-ERCGNGCNGGF 193

  Fly   187 VSVAF-NYTRDHGIATKESYPYEPVSGE-----CLWKSDRSAGTLSGYVTLGNYDERELAEVVYN 245
            |..|: ....:.|:|:::.||::   |:     ||.|..:....:..:..|.| :|:.:|..:..
Mouse   194 VWDAYLTVLNNSGLASEKDYPFQ---GDRKPHRCLAKKYKKVAWIQDFTMLSN-NEQAIAHYLAV 254

  Fly   246 IGPVAVSIDHLHEEFDQYSGGVL-SIPACRSKRQDLTHSVLLVGFG------------TH----R 293
            .||:.|:|:  .:....|..||: :.|:....|| :.|||||||||            :|    |
Mouse   255 HGPITVTIN--MKLLQHYQKGVIKATPSSCDPRQ-VDHSVLLVGFGKEKEGMQTGTVLSHSRKRR 316

  Fly   294 KWGDYWIIKNSYGTDWGESGYLKLARNANNMCGVASLP 331
            ....|||:|||:|..|||.||.:|.| .||.|||...|
Mouse   317 HSSPYWILKNSWGAHWGEKGYFRLYR-GNNTCGVTKYP 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 15/61 (25%)
Peptidase_C1A 120..334 CDD:239068 79/236 (33%)
CtswNP_034115.2 Inhibitor_I29 40..96 CDD:214853 15/63 (24%)
Peptidase_C1 126..356 CDD:278538 79/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.