DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctsl

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_034114.1 Gene:Ctsl / 13039 MGIID:88564 Length:334 Species:Mus musculus


Alignment Length:351 Identity:120/351 - (34%)
Similarity:190/351 - (54%) Gaps:51/351 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ILLLLVELGL-TAVS--------DTEWDQYKAKYNKQY-RNRDKYHRALYEQRVLAVESHNQLYL 67
            :||||..|.| ||::        ..||.|:|:.:.:.| .|.:::.||::|:.:..::.||..|.
Mouse     3 LLLLLAVLCLGTALATPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYS 67

  Fly    68 QGKVAFKMGLNKFSDTDQRILFNYRSSIPAPLETSTNALTETVNYKRYD--------------QI 118
            .|:..|.|.:|.|.|                  .:.....:.||..|:.              :|
Mouse    68 NGQHGFSMEMNAFGD------------------MTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKI 114

  Fly   119 TEGIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCV-PYPNNGC 182
            .:.:|||:.|.::||.:|| :|.||||||.||.||..|..|.|.|:.||.::||||. ...|.||
Mouse   115 PKSVDWREKGCVTPVKNQG-QCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGC 178

  Fly   183 SGGWVSVAFNYTRDH-GIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNI 246
            :||.:..||.|.::: |:.::||||||...|.|.::::.:....:|:|.:.. .|:.|.:.|..:
Mouse   179 NGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQ-QEKALMKAVATV 242

  Fly   247 GPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGF---GTHRKWGDYWIIKNSYGTD 308
            ||::|::|..|.....||.|:...|.|.||  :|.|.|||||:   ||......||::|||:|::
Mouse   243 GPISVAMDASHPSLQFYSSGIYYEPNCSSK--NLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSE 305

  Fly   309 WGESGYLKLARNANNMCGVASLPQYP 334
            ||..||:|:|::.:|.||:|:...||
Mouse   306 WGMEGYIKIAKDRDNHCGLATAASYP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 17/55 (31%)
Peptidase_C1A 120..334 CDD:239068 88/218 (40%)
CtslNP_034114.1 Inhibitor_I29 29..87 CDD:214853 17/75 (23%)
Peptidase_C1 114..331 CDD:365882 89/220 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.