DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctsk

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_031828.2 Gene:Ctsk / 13038 MGIID:107823 Length:329 Species:Mus musculus


Alignment Length:334 Identity:119/334 - (35%)
Similarity:191/334 - (57%) Gaps:17/334 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VHGLILLLLVELGLT--AVSDTEWDQYKAKYNKQYRNR-DKYHRAL-YEQRVLAVESHNQLYLQG 69
            |...:||.:|...|:  .:.||:|:.:|..:.|||.:: |:..|.| :|:.:..:.:||.....|
Mouse     3 VFKFLLLPMVSFALSPEEMLDTQWELWKKTHQKQYNSKVDEISRRLIWEKNLKQISAHNLEASLG 67

  Fly    70 KVAFKMGLNKFSD-TDQRILFNYRSSIPAPLETSTNALTETVNYKRYDQITEGIDWRQYGYISPV 133
            ...:::.:|...| |.:.::.........|..:.:|....|..::  .::.:.||:|:.||::||
Mouse    68 VHTYELAMNHLGDMTSEEVVQKMTGLRIPPSRSYSNDTLYTPEWE--GRVPDSIDYRKKGYVTPV 130

  Fly   134 GDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYTRDH- 197
            .:|| :|.||||||::|.||..:.||.|.|:.|||::|||||. .|.||.||:::.||.|.:.: 
Mouse   131 KNQG-QCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVT-ENYGCGGGYMTTAFQYVQQNG 193

  Fly   198 GIATKESYPYEPVSGECLWKSDRSAGTLSGY--VTLGNYDERELAEVVYNIGPVAVSIDHLHEEF 260
            ||.::::|||......|::.:...|....||  :.:||  |:.|...|..:||::||||.....|
Mouse   194 GIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGN--EKALKRAVARVGPISVSIDASLASF 256

  Fly   261 DQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNANNMC 325
            ..||.||.....|  .|.::.|:||:||:|| :|...:||||||:|..||..||..||||.||.|
Mouse   257 QFYSRGVYYDENC--DRDNVNHAVLVVGYGT-QKGSKHWIIKNSWGESWGNKGYALLARNKNNAC 318

  Fly   326 GVASLPQYP 334
            |:.::..:|
Mouse   319 GITNMASFP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 15/57 (26%)
Peptidase_C1A 120..334 CDD:239068 93/216 (43%)
CtskNP_031828.2 Inhibitor_I29 26..85 CDD:214853 15/58 (26%)
Peptidase_C1A 116..327 CDD:239068 93/217 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.