DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and Ctsc

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_034112.3 Gene:Ctsc / 13032 MGIID:109553 Length:462 Species:Mus musculus


Alignment Length:317 Identity:94/317 - (29%)
Similarity:149/317 - (47%) Gaps:54/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RDKYHRALYEQRVLAVESHNQLYLQG-------------KVAFKMGLNKFSDTDQRILFNYRSSI 95
            :::|...||        :||..:::.             |...||.|.   |..:|...:.|...
Mouse   160 QERYSERLY--------THNHNFVKAINTVQKSWTATAYKEYEKMSLR---DLIRRSGHSQRIPR 213

  Fly    96 PAPLETSTNALTETVNYKRYDQITEGIDWRQ---YGYISPVGDQGTECLSCWAFSTSGVLEAHMA 157
            |.|...:.....:.:|      :.|..|||.   ..|:|||.:| ..|.||::|::.|:|||.:.
Mouse   214 PKPAPMTDEIQQQILN------LPESWDWRNVQGVNYVSPVRNQ-ESCGSCYSFASMGMLEARIR 271

  Fly   158 KKYGN-LVP-LSPKHLVDCVPYPNNGCSGGW-VSVAFNYTRDHGIATKESYPYEPVSGECLWKSD 219
            ....| ..| |||:.:|.|.||. .||.||: ..:|..|.:|.|:..:..:||......|..:.:
Mouse   272 ILTNNSQTPILSPQEVVSCSPYA-QGCDGGFPYLIAGKYAQDFGVVEESCFPYTAKDSPCKPREN 335

  Fly   220 RSAGTLSGYVTLGNY----DERELAEVVYNIGPVAVSIDHLHEEFDQYSGGV-----LSIPACRS 275
            ......|.|..:|.:    :|..:...:...||:||:.: :|::|..|..|:     ||.|   .
Mouse   336 CLRYYSSDYYYVGGFYGGCNEALMKLELVKHGPMAVAFE-VHDDFLHYHSGIYHHTGLSDP---F 396

  Fly   276 KRQDLT-HSVLLVGFGTHRKWG-DYWIIKNSYGTDWGESGYLKLARNANNMCGVASL 330
            ...:|| |:|||||:|.....| :|||||||:|::||||||.::.|..:. |.:.|:
Mouse   397 NPFELTNHAVLLVGYGRDPVTGIEYWIIKNSWGSNWGESGYFRIRRGTDE-CAIESI 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 10/53 (19%)
Peptidase_C1A 120..334 CDD:239068 79/228 (35%)
CtscNP_034112.3 CathepsinC_exc 26..138 CDD:285926
Pox_I6 168..>204 CDD:252691 8/46 (17%)
Peptidase_C1A_CathepsinC 230..459 CDD:239112 79/230 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.