DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and CTSC

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001805.4 Gene:CTSC / 1075 HGNCID:2528 Length:463 Species:Homo sapiens


Alignment Length:304 Identity:92/304 - (30%)
Similarity:146/304 - (48%) Gaps:25/304 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NRDKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSDTDQ-RILFNYRSSIPAPLETSTNAL 106
            :::||...||:.....|::.|.:.........|.....:..|. |....:...||.|   ....|
Human   159 SQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRP---KPAPL 220

  Fly   107 TETVNYKRYDQITEGIDWRQ---YGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGN-LVP-L 166
            |..:..|.. .:....|||.   ..::|||.:|.: |.||::|::.|:|||.:.....| ..| |
Human   221 TAEIQQKIL-HLPTSWDWRNVHGINFVSPVRNQAS-CGSCYSFASMGMLEARIRILTNNSQTPIL 283

  Fly   167 SPKHLVDCVPYPNNGCSGGW-VSVAFNYTRDHGIATKESYPYEPVSGECLWKSDRSAGTLSGYVT 230
            ||:.:|.|..|. .||.||: ..:|..|.:|.|:..:..:||......|..|.|......|.|..
Human   284 SPQEVVSCSQYA-QGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHY 347

  Fly   231 LGNY-----DERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQ--DLT-HSVLLV 287
            :|.:     :.....|:|:: ||:||:.: ::::|..|..|:......|....  :|| |:||||
Human   348 VGGFYGGCNEALMKLELVHH-GPMAVAFE-VYDDFLHYKKGIYHHTGLRDPFNPFELTNHAVLLV 410

  Fly   288 GFGTHRKWG-DYWIIKNSYGTDWGESGYLKLARNANNMCGVASL 330
            |:||....| ||||:|||:||.|||:||.::.|..:. |.:.|:
Human   411 GYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDE-CAIESI 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 7/41 (17%)
Peptidase_C1A 120..334 CDD:239068 77/226 (34%)
CTSCNP_001805.4 CathepsinC_exc 26..138 CDD:312344
Peptidase_C1A_CathepsinC 231..460 CDD:239112 77/228 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.