DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and LOC100496172

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_002938925.2 Gene:LOC100496172 / 100496172 -ID:- Length:332 Species:Xenopus tropicalis


Alignment Length:317 Identity:102/317 - (32%)
Similarity:167/317 - (52%) Gaps:29/317 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DTEWDQYKAKYNKQY--RNRDKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSDTDQRILF 89
            |.||:.:|:||.|.|  ..|:.:.|.::|.....|:.||||..||...:::.:|:|:|.      
 Frog    24 DQEWNAWKSKYGKTYISHEREFFRRKIWEDSWEKVQKHNQLADQGLKKYRLEMNQFADK------ 82

  Fly    90 NYRSSIPAPLETSTN-----ALTETVNYKRYDQITEGIDWRQYGYISPVGDQGTECLSCWAFSTS 149
            ..:..:..|...||.     |.....:|.|..::.:..|||:...::||.:||..|.|||||:..
 Frog    83 TAQDHVSRPCFRSTPKSGRFASAPVYSYDRNTELPKEADWRKSKCVTPVRNQGELCGSCWAFAAI 147

  Fly   150 GVLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYTRDHGIATKESYPYEPVSGEC 214
            .|||:....|...::..|.:..||| ...|:||.|||...||.:..::||..::.|.|.....||
 Frog   148 SVLESRYCIKKNKVIYFSEQQFVDC-DEKNDGCCGGWPIDAFEHVAENGIMRRKDYEYTQQKNEC 211

  Fly   215 LWKSDRSAG-TLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQ 278
            .:.|:::.. .::.:.||.  :|:.:|..|...||:.|:|. :.||...|..|:.. ..|   .:
 Frog   212 GYNSNKAVMLNVTKFYTLP--EEQNMAMSVALEGPITVAIG-VSEELQMYEKGIFD-GEC---AE 269

  Fly   279 DLTHSVLLVGFGT------HRKWGDYWIIKNSYGTDWGESGYLKLARNANNMCGVAS 329
            ::.|:|.:||:||      ..:..||||||||:|.:|||:||:::.|| :|.|.:|:
 Frog   270 EVNHAVTIVGYGTKAAENEDEEDEDYWIIKNSWGKNWGENGYIRMKRN-SNQCDIAT 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 19/56 (34%)
Peptidase_C1A 120..334 CDD:239068 75/217 (35%)
LOC100496172XP_002938925.2 Inhibitor_I29 27..83 CDD:214853 19/61 (31%)
Peptidase_C1A 117..330 CDD:239068 75/218 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.