DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and LOC100333521

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:XP_002661007.2 Gene:LOC100333521 / 100333521 -ID:- Length:301 Species:Danio rerio


Alignment Length:293 Identity:71/293 - (24%)
Similarity:114/293 - (38%) Gaps:68/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 FKMGLNKFSDTDQRILFNYRSSIP----APLETSTNALTETV----NYKRYDQITEGIDWRQY-- 127
            |...||.|..|:.   |.....:|    .|::....:..:|.    .|.....:....|||..  
Zfish     8 FSFLLNVFVHTEG---FTEVQPLPDSCYKPMKDHRPSFIKTYARPHEYLNVSDLPASWDWRNIDG 69

  Fly   128 -GYISPVGDQGTE--CLSCWAFSTSGVLEAHMAKKYGNLVP---LSPKHLVDCVPYPNNGCSGGW 186
             .|:|...:|...  |.||||..::..|...:..|.....|   ||.::::||  .....|.||.
Zfish    70 KNYVSITRNQHIPQYCGSCWAMGSTSALADRINIKRKGAWPSAYLSVQNVIDC--GKAGSCFGGD 132

  Fly   187 VSVAFNYTRDHGIATKESYPYEPVSGEC----------------------LWKSDRSAGTLSGYV 229
            ....:.|..:|||..:....|:..:.:|                      :||.. ..|.:||  
Zfish   133 HLGVYAYANEHGIPDETCNNYQARNQKCDPFNQCGTCSFFGSCSIIKNYTVWKVG-DYGDISG-- 194

  Fly   230 TLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGV------LSIPACRSKRQDLTHSVLLVG 288
                 .:|..||:..| ||::.:| ...:..:.|.|||      ||:|         .|.:.:.|
Zfish   195 -----RDRMKAEIFKN-GPISCAI-MATKGLEAYDGGVFAEFHILSMP---------NHIISVAG 243

  Fly   289 FGTHRKWGDYWIIKNSYGTDWGESGYLKLARNA 321
            :|......:|||::||:|..|||||:.::..:|
Zfish   244 WGVTEDGTEYWIVRNSWGEFWGESGWARIVTSA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458 5/11 (45%)
Peptidase_C1A 120..334 CDD:239068 61/238 (26%)
LOC100333521XP_002661007.2 Peptidase_C1A_CathepsinX 58..299 CDD:239149 61/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.