DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11459 and ctsz

DIOPT Version :9

Sequence 1:NP_001287191.1 Gene:CG11459 / 40741 FlyBaseID:FBgn0037396 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001106427.1 Gene:ctsz / 100127597 XenbaseID:XB-GENE-959211 Length:296 Species:Xenopus tropicalis


Alignment Length:233 Identity:68/233 - (29%)
Similarity:104/233 - (44%) Gaps:53/233 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 DWRQY---GYISPVGDQGTE--CLSCWAF-STSGVLEAHMAKKYGNLVP---LSPKHLVDCVPYP 178
            |||..   .|:|...:|...  |.||||. |||.:.:....|:.| :.|   ||.:|::||.   
 Frog    58 DWRNLNGTNYVSTTRNQHIPQYCGSCWAHGSTSAMADRINIKRKG-VWPSAYLSVQHVIDCA--- 118

  Fly   179 NNG-CSGGWVSVAFNYTRDHGIATKESYPYEPVSGEC----------------------LWKSDR 220
            |.| |.||.....:.|...|||..:....|:....:|                      |||.. 
 Frog   119 NAGSCEGGDHGGVWEYANSHGIPDETCNNYQARDQKCDKFNQCGTCVTFGKCFYLSNYTLWKVG- 182

  Fly   221 SAGTLSGYVTLGNYDERELAEVVYNIGPVAVSIDHLHEEFDQYSGGVLS--IPACRSKRQDLTHS 283
            ..|::||       .|:.:|| :|..||::..| ...|:.|.|:||:.:  .|:..     :.|.
 Frog   183 DFGSVSG-------REKMMAE-IYKNGPISCGI-MATEKLDAYTGGLYAEYQPSAM-----INHI 233

  Fly   284 VLLVGFGTHRKWGDYWIIKNSYGTDWGESGYLKLARNA 321
            |.:.|:|......:|||::||:|..|||.|:|::..:|
 Frog   234 VSVAGWGLDESGAEYWIVRNSWGEPWGERGWLRIVTSA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11459NP_001287191.1 Inhibitor_I29 30..85 CDD:285458
Peptidase_C1A 120..334 CDD:239068 68/233 (29%)
ctszNP_001106427.1 Peptidase_C1A_CathepsinX 53..294 CDD:239149 68/233 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.