DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rm62 and CG7483

DIOPT Version :9

Sequence 1:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster


Alignment Length:391 Identity:133/391 - (34%)
Similarity:206/391 - (52%) Gaps:25/391 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 IQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHIN 344
            |..|:.::|.:.:::.|...|::.|:|||.:.....:.|.:.:..|::|:|||..:.:..     
  Fly    25 IPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISI----- 84

  Fly   345 NQQPLQRGDGPI----ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGC 405
                ||..|..:    .|.|:||||||.|||:|....|....|:.....||...|..:|.|..|.
  Fly    85 ----LQSLDTTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTNLGEDIRKLDYGQ 145

  Fly   406 EIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWP 470
            .||..||||:.|.:.......:....|||||||.||:.||:.||..:...:.|..|.::.|||.|
  Fly   146 HIVSGTPGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLP 210

  Fly   471 KEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIII 535
            .|:.::...|:.:.|:|.:...||:. ..|:|.....:.  :|.|..| |.|:|||. :..:.:|
  Fly   211 HEILEMTSKFMTDPIRILVKRDELTL-EGIKQFFVAVER--EEWKFDT-LCDLYDTL-TITQAVI 270

  Fly   536 FVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIK 600
            |..|||:||.|...:|.......::|||..|.|||.:::|||:|:|.:|:.|||.|||:||..:.
  Fly   271 FCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVS 335

  Fly   601 YVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLAR 665
            .|||:|.|.|.|.|||||||:||...||.:..|...::       :.:||:..|..:..::.:..
  Fly   336 LVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDD-------IRILRDIEQYYSTQIDEMPM 393

  Fly   666 N 666
            |
  Fly   394 N 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 132/379 (35%)
DEADc 283..488 CDD:238167 66/208 (32%)
HELICc 499..633 CDD:238034 58/133 (44%)
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 133/391 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451771
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.