DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rm62 and BoYb

DIOPT Version :9

Sequence 1:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_649430.1 Gene:BoYb / 40512 FlyBaseID:FBgn0037205 Length:1059 Species:Drosophila melanogaster


Alignment Length:481 Identity:98/481 - (20%)
Similarity:172/481 - (35%) Gaps:135/481 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 PIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNF--VGIAKTGSGKTLGYILP--- 338
            |::.|:||.|...:::.:|..|......:|:..||....||..  :.:....||:|..||.|   
  Fly    52 PVRRFAEVSLLPDILETMRNLGLNRLLRLQSYTWPHLAGGSGHGAMIVGSPASGRTFAYIPPVCH 116

  Fly   339 ----AIVHINNQ-----QPLQRGD--GPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFG-- 390
                |::....|     ..:.:.|  |||||:|.|......|:..:.......::..::....  
  Fly   117 AVSRALMDFTGQCEDVEHDISQPDRYGPIALILVPDLRRVHQVSAMCLALLRKAHKNDSVTLALN 181

  Fly   391 -GAPKGGQ-MRDLQRGCEIVIATPGRLIDFL--SAGSTNLKRCTYLVLDEADRM----------- 440
             .:.|..| ...|..|...::|||.:|:.|.  :.|........:||.|:.|.|           
  Fly   182 VSSTKSSQFFLKLLNGVGCLVATPAQLVWFWQEAPGLMRFPCLQFLVYDDVDLMSREQLQDVQQV 246

  Fly   441 ----LDMGFEPQI--------RKIVSQIRP--DRQTLMWSATWPKEVKQLAEDFLGNYIQINIGS 491
                |.:...||:        ..::|::|.  |:..|::.     ::.:.|. :.|..|:|:|..
  Fly   247 LQEILPLSHSPQVVMVSKSYCHTLMSKLRAVNDKPALVFG-----DILEAAL-YGGTRIRISIMR 305

  Fly   492 LELSANHNIRQVVDVCDEFSKEEKLKTLL--SD--------------------IYDTSE------ 528
            .|..||    .||.:..:.|.|| .:|::  ||                    .|.|::      
  Fly   306 SEAKAN----AVVQMLQQCSPEE-FRTVIFCSDDGDMQCLVAALEVQHYSCLPYYQTADLEVRQQ 365

  Fly   529 -------SPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVA 586
                   |.|.|::..:....:|  :|...:.      ||...|.|...|.||..:.        
  Fly   366 VHSWQARSNGVILLCTDNCPELD--IRDAHTI------IHHSMSHSWSKFKLRHLKI-------- 414

  Fly   587 TDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGT-SFAFFTKNNAKQAKALVDVLR 650
                                    |::..:.:..|.....|.. |......||.:|...|||.| 
  Fly   415 ------------------------SDNLCNMVKPTASIVKKPLYSLVLLDDNNHRQLPRLVDFL- 454

  Fly   651 EANQEINPALENLARNSRYDGGGGRS 676
            :.:|:::..|..:|:..|.:.|..|:
  Fly   455 QLHQKVDHRLVEVAKRIRQELGKARN 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 92/458 (20%)
DEADc 283..488 CDD:238167 53/251 (21%)
HELICc 499..633 CDD:238034 26/169 (15%)
BoYbNP_649430.1 P-loop_NTPase 81..263 CDD:304359 40/181 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.