DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rm62 and Dbp73D

DIOPT Version :9

Sequence 1:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_476833.1 Gene:Dbp73D / 39871 FlyBaseID:FBgn0004556 Length:687 Species:Drosophila melanogaster


Alignment Length:537 Identity:128/537 - (23%)
Similarity:218/537 - (40%) Gaps:141/537 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 QDLPMRPVDFSNL-----APFKKNFYQEHPN-VANRSPYEVQRYREEQEITVRGQVPNPIQDFSE 285
            :|:|..  :|..|     |..||....:.|| :|:.:..|....:.|:|:..           ||
  Fly    85 EDVPSN--EFQVLGGDDSAAKKKKVQMQLPNWLAHPTIIEGGSLQPEEEVPA-----------SE 136

  Fly   286 V-----HLPDYVMKEIRRQGYK---------APTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYI 336
            .     :|..|..:.:::...|         .|..::|...|......:....|.|||||||.:.
  Fly   137 AIDQLDYLEKYTCQALKQMKIKRLFPVQKQVIPWILEAHAKPPPFRPRDICVSAPTGSGKTLAFA 201

  Fly   337 LPAIVHINNQQPLQRGDGPI-ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRD 400
            :|.:     |...||.|..: |||:.|..|||.|:.:|.:|..|.:.: ..|:..   |..::.|
  Fly   202 IPIV-----QLLSQRVDCKVRALVVLPVAELALQVYRVISELCSKTEL-EVCLLS---KQHKLED 257

  Fly   401 LQ-------RG-----CEIVIATPGRLIDFLSAGSTN---LKRCTYLVLDEADRMLDMGF----- 445
            .|       :|     .:||:.|||||:|.|.|  |.   ||...:||:|||||::|..|     
  Fly   258 EQEKLVEQYKGKYYSKADIVVTTPGRLVDHLHA--TKGFCLKSLKFLVIDEADRIMDAVFQNWLY 320

  Fly   446 --EPQIRKIVSQIRPDRQT-----------------LMWSATWPKEVKQLAE------------- 478
              :..:::...|:....|.                 |::|||..::.::|.:             
  Fly   321 HLDSHVKETTDQLLAGTQAPLCYAELQASFGKQPHKLLFSATLSQDPEKLQDLRLFQPRLFATVL 385

  Fly   479 ----------------------DFLGNYIQINIGSLELSANHNIRQV-VDVCDEFSKEEKLKTLL 520
                                  .|:|.|..    ..||:..:.:.:: :.....|:..||.|...
  Fly   386 TMPVLKDATEEGADTEALTDPGQFVGRYTT----PAELTEQYCVTELRLKPLTVFALVEKYKWKR 446

  Fly   521 SDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILV 585
            ...:..|......:.||        |....:.:..:...:.|:.|...|:..||:|.:||.|.|:
  Fly   447 FLCFTNSSDQATRLTFV--------LKVLFQKYSTKVSELSGNLSAKVRNERLRDFAAGKINGLI 503

  Fly   586 ATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLR 650
            .:|..|||:||..:..|::::.|::...||||:|||.|:..|||:....|:.:....|   .:|.
  Fly   504 CSDALARGIDVADVDVVLSYETPRHITTYIHRVGRTARAGRKGTAVTVLTEQDMTLFK---KILS 565

  Fly   651 EANQ------EINPALE 661
            :||:      .::|.:|
  Fly   566 DANKGLGEEIHVSPDIE 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 113/471 (24%)
DEADc 283..488 CDD:238167 69/293 (24%)
HELICc 499..633 CDD:238034 37/134 (28%)
Dbp73DNP_476833.1 PRK11192 149..629 CDD:236877 111/460 (24%)
DEAD 162..370 CDD:278688 60/218 (28%)
HELICc 418..551 CDD:238034 39/140 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451759
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.