DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rm62 and CG9253

DIOPT Version :9

Sequence 1:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_610090.1 Gene:CG9253 / 35379 FlyBaseID:FBgn0032919 Length:507 Species:Drosophila melanogaster


Alignment Length:476 Identity:153/476 - (32%)
Similarity:235/476 - (49%) Gaps:75/476 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 EEQEITVRGQVPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSG 330
            |||::|           :.::.|.:.:.:......:|||:.||.:..|:|:.|.:.:|:|:||||
  Fly    57 EEQKLT-----------WKDLGLNEALCQACDELKWKAPSKIQREAIPVALQGKDVIGLAETGSG 110

  Fly   331 KTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKG 395
            ||..:.|| |:|...:.| ||   ..||||.||||||.||.:.....||...::...|.||....
  Fly   111 KTGAFALP-ILHALLENP-QR---YFALVLTPTRELAFQIGEQFEALGSGIGIKCCVVVGGMDMV 170

  Fly   396 GQMRDLQRGCEIVIATPGRLIDFL-SAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPD 459
            .|...|.:...|:|||||||:|.| :....|||...|||:|||||:|:|.||.::.||:..:..:
  Fly   171 AQGLQLAKKPHIIIATPGRLVDHLENMKGFNLKAIKYLVMDEADRILNMDFEVELDKILKVLPRE 235

  Fly   460 RQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEF-------SKEEKLK 517
            |:|.::|||..|:||:|....|.:.:::.:.        |..|.|:...:.       .|:..|.
  Fly   236 RRTFLFSATMTKKVKKLQRASLKDPVKVEVS--------NKYQTVEQLQQSYLFIPVKYKDVYLV 292

  Fly   518 TLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSN 582
            .:|:::...|     .:||..|..........:|:.|:....:||..||::|...|.:|::...:
  Fly   293 HILNELAGNS-----FMIFCSTCNNTVKTALMLRALGLAAIPLHGQMSQNKRLAALNKFKAKNRS 352

  Fly   583 ILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFT------------ 635
            ||::||||:||||:..:..|:|||.|.:|:|||||:|||.|:...|.:....:            
  Fly   353 ILISTDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITLVSQYDIELYQRIEH 417

  Fly   636 ---------KNNAKQAKALVDVLREANQEINPALENL--ARNSRYDGG----------GGRSR-- 677
                     |....:..||.:.:.||.:.....|::|  .|.....||          |.|.|  
  Fly   418 LLGKQLTLYKCEEDEVMALQERVAEAQRTAKLELKDLEDTRGGHKRGGDTHDDSENFTGARKRMK 482

  Fly   678 -YGGGGGGGR--FGGGGFKKG 695
             .||.|||||  ||...:.||
  Fly   483 PMGGTGGGGRKSFGKKNWSKG 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 130/404 (32%)
DEADc 283..488 CDD:238167 80/205 (39%)
HELICc 499..633 CDD:238034 45/140 (32%)
CG9253NP_610090.1 SrmB 34..498 CDD:223587 151/469 (32%)
DEADc 63..264 CDD:238167 80/205 (39%)
HELICc 274..403 CDD:238034 42/133 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.