DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rm62 and eIF4A

DIOPT Version :9

Sequence 1:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster


Alignment Length:392 Identity:137/392 - (34%)
Similarity:217/392 - (55%) Gaps:31/392 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 DFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQ 346
            :|.:::|.:.:::.|...|::.|:|||.:.....:.|.:.:..|::|:|||..:.: ||      
  Fly    31 NFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSI-AI------ 88

  Fly   347 QPLQRGDGPI----ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEI 407
              ||:.|..|    ||:||||||||.|||:|....|....|.:....||.......|.|:.||.:
  Fly    89 --LQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHV 151

  Fly   408 VIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKE 472
            |:.||||:.|.::......:.....||||||.||..||:.||:.:...:.||.|.::.|||.|.:
  Fly   152 VVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPD 216

  Fly   473 VKQLAEDFLGNYIQINIGSLELSANHNIRQ-VVDVCDEFSKEE--KLKTLLSDIYDTSESPGKII 534
            |.:::..|:.:.:.|.:...||:. ..|:| .|:|     |:|  ||.| |.|:|||. |..:.:
  Fly   217 VLEVSRCFMRDPVSILVKKEELTL-EGIKQFYVNV-----KQENWKLGT-LCDLYDTL-SITQSV 273

  Fly   535 IFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGI 599
            ||..|:|:||.|.:.:........|:|||..|.:|:.::::||||.|.:|:.||:.|||:||..:
  Fly   274 IFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQV 338

  Fly   600 KYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLA 664
            ..|||:|.|.|.|:|||||||.||...||.:..|.|.::.:       :|::..|..:..:|.:.
  Fly   339 SLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRR-------ILKDIEQFYHTTIEEMP 396

  Fly   665 RN 666
            .|
  Fly   397 AN 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 135/380 (36%)
DEADc 283..488 CDD:238167 69/208 (33%)
HELICc 499..633 CDD:238034 59/136 (43%)
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 137/392 (35%)
DEADc 32..232 CDD:238167 69/208 (33%)
Helicase_C 254..358 CDD:278689 46/105 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451762
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.