DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rm62 and CG6227

DIOPT Version :9

Sequence 1:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_573020.2 Gene:CG6227 / 32464 FlyBaseID:FBgn0030631 Length:1224 Species:Drosophila melanogaster


Alignment Length:472 Identity:197/472 - (41%)
Similarity:294/472 - (62%) Gaps:25/472 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 VDFSNL--APFKKNFYQEHPNVANRSPYEVQRYREEQE-ITVRGQ-VPNPIQDFSEVHLPDYVMK 294
            :|.|::  |||:||||.|.|.:...:..:|::||.:.| |.|:|: .|.||:.:::..:....|:
  Fly   459 IDHSSVTYAPFRKNFYVEVPELTRMTAADVEKYRSDLEGIQVKGKGCPKPIKTWAQCGVSKKEME 523

  Fly   295 EIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIALV 359
            .:||.|::.||.||.|..|..|||.:.:|||||||||||.:|||...||.:|..::.|||.||::
  Fly   524 VLRRLGFEKPTPIQCQAIPAIMSGRDLIGIAKTGSGKTLAFILPMFRHILDQPSMEDGDGAIAII 588

  Fly   360 LAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGS- 423
            :||||||..||.:...:|..|..:|..||:||.....|:.:|:||.||::.||||:||.|:|.| 
  Fly   589 MAPTRELCMQIGKDIRKFSKSLGLRPVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSG 653

  Fly   424 --TNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQ 486
              |||:|.||:||||||||.|||||||:.:|:..:||||||:|:|||:|::::.||...|...|:
  Fly   654 RVTNLRRVTYVVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILKKPIE 718

  Fly   487 INIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIR 551
            :.:|...:... .:.|.|.:.::.:|..||..||. ||   :..|.||:||:.:...|.|:|.:.
  Fly   719 VIVGGRSVVCK-EVEQHVVILNDDAKFFKLLELLG-IY---QEAGSIIVFVDKQENADILLRDLM 778

  Fly   552 SFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIH 616
            .....|.::||...|.:||..:.:|:|||..:|:||.||||||||..:..|:|:|.|.:.|||:|
  Fly   779 KASYPCMSLHGGIDQFDRDSTIIDFKSGKVRLLIATSVAARGLDVKDLILVVNYDVPNHYEDYVH 843

  Fly   617 RIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLR--EANQEINPALENLARNSRYDG---GGGRS 676
            |.|||||:..||:::.|.|...::.|.   |::|  :.:..:.|| |..|..:.|..   ..|::
  Fly   844 RCGRTGRAGKKGSAYTFITPEQSRYAG---DIIRAMDLSGTLIPA-ELQALWTEYKALQEAEGKT 904

  Fly   677 RYGGGGGGGRFGGGGFK 693
            .:.|||    |.|.|||
  Fly   905 VHTGGG----FSGKGFK 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 163/380 (43%)
DEADc 283..488 CDD:238167 102/207 (49%)
HELICc 499..633 CDD:238034 54/133 (41%)
CG6227NP_573020.2 SrmB 482..967 CDD:223587 186/449 (41%)
DEADc 516..719 CDD:238167 102/202 (50%)
HELICc 733..860 CDD:238034 54/130 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451469
Domainoid 1 1.000 152 1.000 Domainoid score I185
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9750
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.