DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rm62 and Gpr149

DIOPT Version :9

Sequence 1:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_620246.1 Gene:Gpr149 / 192251 RGDID:619890 Length:730 Species:Rattus norvegicus


Alignment Length:94 Identity:26/94 - (27%)
Similarity:39/94 - (41%) Gaps:14/94 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LFSSASSSGTFASSSSLCTEQRQQFHGSRRNRETILFPSTYSSLQAQSQRAFRDSSKPDSDDYVD 113
            :.|:.|.|.|...|.||...:::....|....||    ::||        .|..:|.||.|..: 
  Rat   635 IISNISQSSTKVRSPSLRYSRKENRFVSCDLGET----ASYS--------LFLPTSDPDGDINI- 686

  Fly   114 SIP-KAEQRTRTRKSLFNDPDERTEEIKI 141
            ||| ..|...:..:....|.|...|||::
  Rat   687 SIPDTVEAHRQNSRRQHQDRDGYQEEIQL 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609
DEADc 283..488 CDD:238167
HELICc 499..633 CDD:238034
Gpr149NP_620246.1 7tm_1 54..>209 CDD:278431
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0331
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.