DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rm62 and DDX5

DIOPT Version :9

Sequence 1:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001307524.1 Gene:DDX5 / 1655 HGNCID:2746 Length:614 Species:Homo sapiens


Alignment Length:556 Identity:316/556 - (56%)
Similarity:377/556 - (67%) Gaps:56/556 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GHSGRGGRGGDRGGDDRRGGGGGGNRFGGGGGGGDYHGIRNGRVEKRRDDRGGGNRFGGGGGFGD 217
            |:|....||.||        |.|..||||.         |.|.:        .|.:||..|    
Human     3 GYSSDRDRGRDR--------GFGAPRFGGS---------RAGPL--------SGKKFGNPG---- 38

  Fly   218 RRGGGGGGSQDLPMRPVDFSNLAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRG-QVPNPIQ 281
                     :.|..:..:...|..|:||||||||::|.|:..||:.||..:|||||| ..|.|:.
Human    39 ---------EKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVL 94

  Fly   282 DFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQ 346
            :|.|.:.|..||..|.||.:..||||||||||:|:||.:.||:|:|||||||.|:||||||||:|
Human    95 NFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQ 159

  Fly   347 QPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIAT 411
            ..|:||||||.||||||||||||:||||.|:..:..:::||::||||||.|:|||:||.||.|||
Human   160 PFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIAT 224

  Fly   412 PGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQL 476
            ||||||||..|.|||:|.||||||||||||||||||||||||.|||||||||||||||||||:||
Human   225 PGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQL 289

  Fly   477 AEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKR 541
            |||||.:||.||||:|||||||||.|:||||.:..|:|||..|:.:|  .||...|.|:||||||
Human   290 AEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEI--MSEKENKTIVFVETKR 352

  Fly   542 RVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFD 606
            |.|.|.|.:|..|.....|||||||.|||:||.||:.||:.||:|||||:|||||:.:|:|||:|
Human   353 RCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYD 417

  Fly   607 YPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLARNSRYDG 671
            ||.:|||||||||||.||...||::.|||.||.||...|:.|||||||.|||.|..|..    |.
Human   418 YPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVE----DR 478

  Fly   672 GGGRSRYGGGGGG------GRFGGGGFKKGSLSNGR 701
            |.||||   |.||      .|:..|  |:|..:..|
Human   479 GSGRSR---GRGGMKDDRRDRYSAG--KRGGFNTFR 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 254/375 (68%)
DEADc 283..488 CDD:238167 149/204 (73%)
HELICc 499..633 CDD:238034 79/133 (59%)
DDX5NP_001307524.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 18/73 (25%)
PTZ00110 6..507 CDD:240273 313/549 (57%)
Q motif 94..122 12/27 (44%)
DEAD box 248..251 2/2 (100%)
Transactivation domain 477..614 14/38 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 477..504 12/31 (39%)
P68HR 498..532 CDD:400414 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 287 1.000 Domainoid score I1590
eggNOG 1 0.900 - - E2759_KOG0331
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53695
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000439
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100364
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R290
SonicParanoid 1 1.000 - - X504
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.710

Return to query results.
Submit another query.