DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rm62 and Ddx5

DIOPT Version :9

Sequence 1:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001342605.1 Gene:Ddx5 / 13207 MGIID:105037 Length:615 Species:Mus musculus


Alignment Length:560 Identity:317/560 - (56%)
Similarity:376/560 - (67%) Gaps:64/560 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 DRDFGHSGRGGRGGDRGGDDRRGGGGGGNRFGGGGGGGDYHGIRNGRVEKRRDDRGGGNRFGGGG 213
            |||        ||.||        |.|..||||.         |.|.:        .|.:||..|
Mouse     7 DRD--------RGRDR--------GFGAPRFGGS---------RTGPL--------SGKKFGNPG 38

  Fly   214 GFGDRRGGGGGGSQDLPMRPVDFSNLAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRG-QVP 277
                         :.|..:..:...|..|:||||||||::|.|:..||..||..:|||||| ..|
Mouse    39 -------------EKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVDTYRRSKEITVRGHNCP 90

  Fly   278 NPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVH 342
            .|:.:|.|.:.|..||..|.||.:..||||||||||:|:||.:.||:|:|||||||.|:||||||
Mouse    91 KPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVH 155

  Fly   343 INNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEI 407
            ||:|..|:||||||.||||||||||||:||||.|:..:..:::||::||||||.|:|||:||.||
Mouse   156 INHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEI 220

  Fly   408 VIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKE 472
            .|||||||||||..|.|||:|.||||||||||||||||||||||||.||||||||||||||||||
Mouse   221 CIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKE 285

  Fly   473 VKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFV 537
            |:|||||||.:||.||||:|||||||||.|:||||.:..|:|||..|:.:|  .||...|.|:||
Mouse   286 VRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEI--MSEKENKTIVFV 348

  Fly   538 ETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYV 602
            |||||.|.|.|.:|..|.....|||||||.|||:||.||:.||:.||:|||||:|||||:.:|:|
Mouse   349 ETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFV 413

  Fly   603 INFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENLARNS 667
            ||:|||.:|||||||||||.||...||::.|||.||.||...|:.|||||||.|||.|..|..  
Mouse   414 INYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVE-- 476

  Fly   668 RYDGGGGRSRYGGGGGG------GRFGGGGFKKGSLSNGR 701
              |.|.||||   |.||      .|:..|  |:|..:..|
Mouse   477 --DRGSGRSR---GRGGMKDDRRDRYSAG--KRGGFNTFR 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 254/375 (68%)
DEADc 283..488 CDD:238167 149/204 (73%)
HELICc 499..633 CDD:238034 79/133 (59%)
Ddx5NP_001342605.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 19/77 (25%)
DEXDc 6..507 CDD:331760 316/556 (57%)
Q motif 94..122 12/27 (44%)
DEAD box 248..251 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 477..504 12/31 (39%)
P68HR 498..532 CDD:285323 4/14 (29%)
P68HR 551..583 CDD:285323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 287 1.000 Domainoid score I1574
eggNOG 1 0.900 - - E2759_KOG0331
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53695
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000439
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100364
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R290
SonicParanoid 1 1.000 - - X504
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.