DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rm62 and ddx59

DIOPT Version :9

Sequence 1:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_031756897.1 Gene:ddx59 / 100488709 XenbaseID:XB-GENE-976229 Length:785 Species:Xenopus tropicalis


Alignment Length:419 Identity:146/419 - (34%)
Similarity:235/419 - (56%) Gaps:12/419 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 YQEHPNVANRSPYEVQRYREEQEITVRG-QVPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQ 310
            |:||..::..|..::...|::..::|.| ::..||.:|.....|..:...|:..||:.||.||.|
 Frog   335 YKEHEFISQLSADQINHLRQQLSLSVHGNEMCKPIMEFDHCQFPPVLSSNIKAAGYEVPTPIQMQ 399

  Fly   311 GWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVAT 375
            ..|:.:.|.:.:..|.||||||..::||||:..     |::.|.|.||:|.||||||.||:..|.
 Frog   400 MIPVGLMGRDILASADTGSGKTAAFLLPAIIRC-----LEKKDSPAALILTPTRELAVQIEGQAK 459

  Fly   376 E-FGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADR 439
            | .....::|...:.||.|...|:..|::|.:::|||||||::.:...|.||.....|::||||.
 Frog   460 ELMRGIPHMRTALLVGGMPLPPQIHRLKQGVQVIIATPGRLLEIIKQDSVNLGDLKILIVDEADT 524

  Fly   440 MLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVV 504
            ||.|||:.|:..|:..:..|.||::.|||.|..::...:..|.:.::|.:|....... |:||:|
 Frog   525 MLKMGFQQQVLDILEVVPHDHQTILVSATIPAGIEAFTKQLLQDPVRITVGEKNQPCT-NVRQIV 588

  Fly   505 DVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSF-GVRCGAIHGDKSQSE 568
            ...:|.||::||..:|:| ....:.|  :::||:.:...|.|...:... |:.|.|:|.||||.|
 Frog   589 LWVEEPSKKKKLFEILND-SKLFQPP--VLVFVDCRLGADLLSDAVSKITGLECVAMHSDKSQVE 650

  Fly   569 RDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAF 633
            |..:|:....|:.:::|:|.|..||||:..:|.|:|||.|.:.::|:|:|||.||...:||:..|
 Frog   651 RMKILQGLLQGEYDVVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQIGRAGRLGHRGTAITF 715

  Fly   634 FTKNNAKQAKALVDVLREANQEINPALEN 662
            ..|||......||..::.....:.|.|.|
 Frog   716 INKNNRNLFWDLVKRVQPTGSLLPPQLLN 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 135/377 (36%)
DEADc 283..488 CDD:238167 76/205 (37%)
HELICc 499..633 CDD:238034 50/134 (37%)
ddx59XP_031756897.1 PHA03247 <29..211 CDD:223021
PLN00206 217..759 CDD:215103 146/419 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.