DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rm62 and ddx46

DIOPT Version :9

Sequence 1:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_002935944.1 Gene:ddx46 / 100145307 XenbaseID:XB-GENE-5787809 Length:1049 Species:Xenopus tropicalis


Alignment Length:486 Identity:194/486 - (39%)
Similarity:291/486 - (59%) Gaps:27/486 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 MRPVDFSNL--APFKKNFYQEHPNVANRSPYEVQRYREEQE-ITVRGQ-VPNPIQDFSEVHLPDY 291
            :.|||...:  ..::||||.|.|.:|..:..||..||.|.| |||:|: .|.||:.:.:..:...
 Frog   317 LEPVDHGKIEYESYRKNFYVEVPELAKMTTEEVNSYRLELEGITVKGKNCPKPIKSWVQCGISMK 381

  Fly   292 VMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPI 356
            ::..:::..|:.||.||||..|..|||.:.:||||||||||:.::||...||.:|:||:.|:|||
 Frog   382 ILNSLKKHAYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRPLEEGEGPI 446

  Fly   357 ALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSA 421
            |:::.||||||.||.:...:|..:..:|..||:||.....|:.:|:||.||::.||||:||.|:|
 Frog   447 AVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAA 511

  Fly   422 GS---TNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGN 483
            .:   |||:|.||:||||||||.|||||||:.:|:..|||||||:|:|||:|:.::.||...|..
 Frog   512 NNGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIIDNIRPDRQTVMFSATFPRAMEALARRILSK 576

  Fly   484 YIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVR 548
            .|::.:|...:..: ::.|.|.|.:|..|..||..||...    :..|.:||||:.:...|.|::
 Frog   577 PIEVQVGGRSVVCS-DVEQHVIVIEEEKKFLKLLELLGHY----QEKGAVIIFVDKQEHADGLLK 636

  Fly   549 FIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSED 613
            .:......|.::||...|.:||.::.:|::|...:||||.||||||||..:..|||:..|.:.||
 Frog   637 DLMRASYPCLSLHGGIDQYDRDSIINDFKNGVCKLLVATSVAARGLDVKQLILVINYACPNHYED 701

  Fly   614 YIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINPALENL----ARNSRYDGGGG 674
            |:||.|||||:..||.:|.|.|::.|:.|..::..|..:...:...||.|    ....:.:|...
 Frog   702 YVHRAGRTGRAGNKGYAFTFITEDQARYAGDIIKALELSGTAVPAELEQLWNEFKEQQKAEGKII 766

  Fly   675 RSRYGGGGGGGRFGGGGFK----KGSLSNGR 701
            :...|       |.|.|||    :.:|:|.|
 Frog   767 KKTSG-------FSGKGFKFDETEQALANER 790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 159/378 (42%)
DEADc 283..488 CDD:238167 99/207 (48%)
HELICc 499..633 CDD:238034 53/133 (40%)
ddx46XP_002935944.1 DEADc_DDX46 360..581 CDD:350711 105/220 (48%)
SrmB 367..825 CDD:223587 174/436 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.