DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83b and Obp99b

DIOPT Version :10

Sequence 1:NP_524242.2 Gene:Obp83b / 40738 FlyBaseID:FBgn0010403 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_651713.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster


Alignment Length:155 Identity:37/155 - (23%)
Similarity:60/155 - (38%) Gaps:45/155 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILLLIGCAAAQEPRRDGEWPPPAILKLGKHFHDI--------------CAPKTGVTDEAIKEFS 56
            ||:||:|.|.......             .|.||.              |..|...::|.::::.
  Fly     4 LIVLLLGLAFVLADHH-------------HHHHDYVVKTHEDLTNYRTQCVEKVHASEELVEKYK 55

  Fly    57 DGQIHEDEALKCYMNCLFHEFEVVD-DNG-DVHMEKVLNAIPG----------EKLRNIMMEASK 109
            ..|..:|....||:.|:|.:|...| ::| |||...:..|.||          :|:.:.....||
  Fly    56 KWQYPDDAVTHCYLECIFQKFGFYDTEHGFDVHKIHIQLAGPGVEVHESDEVHQKIAHCAETHSK 120

  Fly   110 GCIHPEGDTLCHKAWWFHQCWKKAD 134
                 |||: |.||:....|:..::
  Fly   121 -----EGDS-CSKAYHAGMCFMNSN 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83bNP_524242.2 PBP_GOBP 28..133 CDD:460193 31/130 (24%)
Obp99bNP_651713.1 PBP_GOBP 24..137 CDD:460193 29/118 (25%)

Return to query results.
Submit another query.