DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83b and Obp83ef

DIOPT Version :10

Sequence 1:NP_524242.2 Gene:Obp83b / 40738 FlyBaseID:FBgn0010403 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_731042.1 Gene:Obp83ef / 40747 FlyBaseID:FBgn0046876 Length:245 Species:Drosophila melanogaster


Alignment Length:110 Identity:18/110 - (16%)
Similarity:38/110 - (34%) Gaps:28/110 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CAPKTGVTDEAIKEFSDGQIHEDEALKCYMNCLFHEFEVVDDNGDVHMEKVLNAI---------- 95
            |:.:...|:..:.::|  ::...|.:.|...|........|.:|:..:|....|.          
  Fly   137 CSRQLNATNVELLQYS--KLKSKEPIPCLFQCFADAMGFYDPDGNWRLENWKQAFGPSGNEDQSS 199

  Fly    96 ----PGEKLRNIMMEASKGCIHPEGDTLCHKAWWFHQ--CWKKAD 134
                .|.:|.....|.:          |...:|.:|:  ||::.:
  Fly   200 GADYSGCRLSGTQREVA----------LSKCSWMYHEYKCWERVN 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83bNP_524242.2 PBP_GOBP 28..133 CDD:460193 18/107 (17%)
Obp83efNP_731042.1 PhBP 28..124 CDD:214783
PhBP 133..234 CDD:214783 18/108 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.