DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83b and Obp83a

DIOPT Version :10

Sequence 1:NP_524242.2 Gene:Obp83b / 40738 FlyBaseID:FBgn0010403 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster


Alignment Length:132 Identity:93/132 - (70%)
Similarity:106/132 - (80%) Gaps:4/132 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLIGCAAAQEPRRDGEWPPPAILKLGKHFHDICAPKTGVTDEAIKEFSDGQIHEDEALKCYMNCL 73
            |::..||||   ||..:|||.|||:.|.|||.|..|||||:.||||||||:|||||.|||||||.
  Fly    46 LILPPAAAQ---RDENYPPPGILKMAKPFHDACVEKTGVTEAAIKEFSDGEIHEDEKLKCYMNCF 107

  Fly    74 FHEFEVVDDNGDVHMEKVLNAIPGEKLRNIMMEASKGCIHPEGDTLCHKAWWFHQCWKKADPVHY 138
            |||.||||||||||:||:...:| ..:|:.:||.||||:|||||||||||||||||||||||.||
  Fly   108 FHEIEVVDDNGDVHLEKLFATVP-LSMRDKLMEMSKGCVHPEGDTLCHKAWWFHQCWKKADPKHY 171

  Fly   139 FL 140
            ||
  Fly   172 FL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83bNP_524242.2 PBP_GOBP 28..133 CDD:460193 76/104 (73%)
Obp83aNP_001287190.1 PhBP 71..167 CDD:214783 72/96 (75%)

Return to query results.
Submit another query.